Free for academic non-profit institutions. Other users need a Commercial license

Aliases for BRCA1 Gene

Aliases for BRCA1 Gene

  • BRCA1, DNA Repair Associated 2 3 5
  • Protein Phosphatase 1, Regulatory Subunit 53 2 3
  • BRCA1/BRCA2-Containing Complex, Subunit 1 2 3
  • Fanconi Anemia, Complementation Group S 2 3
  • Breast Cancer 1, Early Onset 2 3
  • RING Finger Protein 53 3 4
  • RNF53 3 4
  • Breast And Ovarian Cancer Susceptibility Protein 1 3
  • Breast Cancer Type 1 Susceptibility Protein 3
  • RING-Type E3 Ubiquitin Transferase BRCA1 4
  • Early Onset Breast Cancer 1 3
  • Breast Cancer 1 2
  • EC 2.3.2.27 4
  • EC 6.3.2 56
  • BROVCA1 3
  • PPP1R53 3
  • BRCAI 3
  • BRCC1 3
  • FANCS 3
  • PNCA4 3
  • IRIS 3
  • PSCP 3

External Ids for BRCA1 Gene

Previous GeneCards Identifiers for BRCA1 Gene

  • GC17P062255
  • GC17M043361
  • GC17M041105
  • GC17M041569
  • GC17M038450
  • GC17M041197
  • GC17M036962

Summaries for BRCA1 Gene

Entrez Gene Summary for BRCA1 Gene

  • This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. [provided by RefSeq, May 2009]

CIViC summary for BRCA1 Gene

  • BRCA1 mutations in the germline have become a hallmark for hereditary breast and ovarian cancers. Variants that have been demonstrated to reduce the function of the protein have been shown to increase risk for these cancers, as well as prostate and pancreatic cancer. These findings have been the impetus for the increased popularity of genetic testing of healthy individuals to assess risk. Variant frequencies in 10,000 women over 70 have been released

GeneCards Summary for BRCA1 Gene

BRCA1 (BRCA1, DNA Repair Associated) is a Protein Coding gene. Diseases associated with BRCA1 include Breast-Ovarian Cancer, Familial 1 and Pancreatic Cancer 4. Among its related pathways are Immune response IFN gamma signaling pathway and SUMOylation. Gene Ontology (GO) annotations related to this gene include RNA binding and ligase activity.

UniProtKB/Swiss-Prot for BRCA1 Gene

  • E3 ubiquitin-protein ligase that specifically mediates the formation of Lys-6-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule nucleation. Required for normal cell cycle progression from G2 to mitosis. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation. Contributes to homologous recombination repair (HRR) via its direct interaction with PALB2, fine-tunes recombinational repair partly through its modulatory role in the PALB2-dependent loading of BRCA2-RAD51 repair machinery at DNA breaks. Component of the BRCA1-RBBP8 complex which regulates CHEK1 activation and controls cell cycle G2/M checkpoints on DNA damage via BRCA1-mediated ubiquitination of RBBP8. Acts as a transcriptional activator (PubMed:20160719).

Gene Wiki entry for BRCA1 Gene

PharmGKB "VIP" Summary for BRCA1 Gene

Additional gene information for BRCA1 Gene

No data available for Tocris Summary , fRNAdb sequence ontologies and piRNA Summary for BRCA1 Gene

Genomics for BRCA1 Gene

GeneHancer (GH) Regulatory Elements for BRCA1 Gene

Promoters and enhancers for BRCA1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH17I043168 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 550.8 -0.8 -821 5 HDGF PKNOX1 FOXA2 SMAD1 ARNT ARID4B SIN3A DMAP1 YY1 SLC30A9 NBR1 BRCA1 BRCA1P1 ENSG00000267340 PIR60622 LOC101929767 ENSG00000267002 NBR2 TMEM106A C17orf53
GH17I043124 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 550.3 +44.7 44664 2.8 HDGF FOXA2 PKNOX1 MLX ARNT ARID4B SIN3A DMAP1 ZNF2 YY1 NBR2 PIR48082 PIR61659 BRCA1 DHX8 HMGN1P29 ENSG00000267758 LINC00910 PSME3 RND2
GH17I043117 Promoter 0.5 EPDnew 550.2 +52.9 52856 0.1 BRCA1 PIR48082 GC17P043556
GH17I043079 Enhancer 0.6 FANTOM5 ENCODE 3.1 +89.7 89736 2.7 HLF ZNF384 HNF4A GC17P043421 RPL21P4 NBR2 VAT1 RND2 RPL27 PTGES3L-AARSD1 PSMC3IP BRCA1 GC17P043556
GH17I043167 Enhancer 0.4 dbSUPER 0.8 +2.2 2223 0.9 SOX5 SOX13 BRCA1P1 ENSG00000267595 PTGES3L BRCA1 LOC101929767 ENSG00000267002 GC17M043141
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around BRCA1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the BRCA1 gene promoter:

Genomic Locations for BRCA1 Gene

Genomic Locations for BRCA1 Gene
chr17:43,044,295-43,170,245
(GRCh38/hg38)
Size:
125,951 bases
Orientation:
Minus strand
chr17:41,196,312-41,277,500
(GRCh37/hg19)

Genomic View for BRCA1 Gene

Genes around BRCA1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
BRCA1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for BRCA1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for BRCA1 Gene

Proteins for BRCA1 Gene

  • Protein details for BRCA1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P38398-BRCA1_HUMAN
    Recommended name:
    Breast cancer type 1 susceptibility protein
    Protein Accession:
    P38398
    Secondary Accessions:
    • E9PFZ0
    • O15129
    • Q1RMC1
    • Q3LRJ0
    • Q3LRJ6
    • Q6IN79
    • Q7KYU9

    Protein attributes for BRCA1 Gene

    Size:
    1863 amino acids
    Molecular mass:
    207721 Da
    Quaternary structure:
    • Heterodimer with BARD1 (PubMed:11573085, PubMed:12890688, PubMed:14976165). Part of the BRCA1-associated genome surveillance complex (BASC), which contains BRCA1, MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the MRE11-RAD50-NBN protein (MRN) complex (PubMed:10783165). This association could be a dynamic process changing throughout the cell cycle and within subnuclear domains (PubMed:10783165). Component of the BRCA1-A complex, at least composed of BRCA1, BARD1, UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1 (PubMed:19261746, PubMed:19261748, PubMed:19261749, PubMed:20351172). Interacts (via the BRCT domains) with ABRAXAS1 (phosphorylated form); this is important for recruitment to sites of DNA damage (PubMed:17525340, PubMed:17643121, PubMed:17643122, PubMed:24316840, PubMed:26778126). Can form a heterotetramer with two molecules of ABRAXAS1 (phosphorylated form) (PubMed:26778126). Component of the BRCA1-RBBP8 complex (PubMed:16101277). Interacts (via the BRCT domains) with RBBP8 (Ser-327 phosphorylated form); the interaction ubiquitinates RBBP8, regulates CHEK1 activation, and involves RBBP8 in BRCA1-dependent G2/M checkpoint control on DNA damage (PubMed:16818604, PubMed:9811458). Associates with RNA polymerase II holoenzyme (PubMed:9662397). Interacts with SMC1A, COBRA1, DCLRE1C, CLSPN (PubMed:11877377, PubMed:15096610, PubMed:15456891). Interacts with CHEK1, CHEK2, BAP1, BRCC3, AURKA, UBXN1 and PCLAF (PubMed:10724175, PubMed:11836499, PubMed:14636569, PubMed:14990569, PubMed:20351172, PubMed:21673012). Interacts (via BRCT domains) with BRIP1 (phosphorylated form) (PubMed:11301010, PubMed:15133502, PubMed:21473589). Interacts with FANCD2 (ubiquitinated form) (PubMed:11239454). Interacts with H2AFX (phosphorylated on Ser-140) (PubMed:12419185). Interacts (via the BRCT domains) with ACACA (phosphorylated form); the interaction prevents dephosphorylation of ACACA (PubMed:12360400, PubMed:16326698, PubMed:16698035, PubMed:18452305). Part of a BRCA complex containing BRCA1, BRCA2 and PALB2 (PubMed:19369211). Interacts directly with PALB2; the interaction is essential for its function in HRR (PubMed:19369211, PubMed:28319063). Interacts directly with BRCA2; the interaction occurs only in the presence of PALB2 which serves as the bridging protein (PubMed:19369211). Interacts (via the BRCT domains) with LMO4; the interaction represses the transcriptional activity of BRCA1 (PubMed:11751867). Interacts (via the BRCT domains) with CCAR2 (via N-terminus); the interaction represses the transcriptional activator activity of BRCA1 (PubMed:20160719). Interacts with EXD2 (PubMed:26807646). Interacts (via C-terminus) with DHX9; this interaction is direct and links BRCA1 to the RNA polymerase II holoenzyme (PubMed:9662397).
    SequenceCaution:
    • Sequence=AAB61673.1; Type=Erroneous translation; Note=Wrong choice of CDS.; Evidence={ECO:0000305}; Sequence=AAI15038.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AAI15038.1; Type=Erroneous termination; Positions=526; Note=Translated as Gln.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for BRCA1 Gene

    Alternative splice isoforms for BRCA1 Gene

neXtProt entry for BRCA1 Gene

Selected DME Specific Peptides for BRCA1 Gene

P38398:
  • AKCSIKG
  • IGQMCEAPVVTREWVLDSVALYQCQELDTYL
  • CPICLEL
  • VVSGLTPEEFMLVYKFAR
  • ITKRSLQ
  • ELQIDSC
  • KSFVKTKC
  • TNKLKRKR
  • EVSIIQSMGYRNRAKRL
  • LICKSERVHS
  • NYPSQEELIKVVDVE
  • KNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQN
  • YSGSSEKI
  • LQTERSVES
  • EEHSMSPEREMGNENIPSTVS
  • HENKTKGDSIQNEKNPN
  • THASSLQHENSSLLLT
  • TRHSTVATECLSKNTEENLLSLKNSL
  • NDIKESSAVFSK
  • RMNVEKAE
  • SNNDLNTTEK
  • KFARKHH
  • EFVCERTLKYFLGIAGGKWVVSYFWVTQSIKE
  • ETSIEMEESELD
  • RGPKLNAMLRLGVLQPEVYKQS
  • GRNHQGP
  • TDYGTQESISLLEVSTLGKAKTE
  • DKELVSDD
  • RFSQLVEELLKII
  • ESETSVSEDCS
  • PFTHTHLAQG
  • RAKRLLQSEPENPSLQET
  • SQSDILTTQQR
  • VVVQPDAWTED
  • LEAVLEQHGSQPS
  • SLDSAKKAACEFSE
  • SQCAAFENPK
  • TPSTEKKVDLNA
  • SKAPKKNRLRRKS
  • TSGLHPEDFIKKADLAVQKTPE
  • DVPWITLNSS
  • PISQNPE
  • NVEKAEFCNKSKQP
  • LEENNQEEQ
  • SLFSSQCS
  • QQLEESGPHDLTE
  • LELVVSRN
  • IPSSTSALKVPQ
  • ECEQKEENQGK
  • LTASTERVNKRMS
  • ANSYNFAKKEN

Post-translational modifications for BRCA1 Gene

  • Autoubiquitinated, undergoes Lys-6-linked polyubiquitination. Lys-6-linked polyubiquitination does not promote degradation.
  • Phosphorylation at Ser-308 by AURKA is required for normal cell cycle progression from G2 to mitosis. Phosphorylated in response to IR, UV, and various stimuli that cause checkpoint activation, probably by ATM or ATR. Phosphorylation at Ser-988 by CHEK2 regulates mitotic spindle assembly.
  • Ubiquitination at posLast=987987
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Abcam antibodies for BRCA1

Domains & Families for BRCA1 Gene

Gene Families for BRCA1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

P38398

UniProtKB/Swiss-Prot:

BRCA1_HUMAN :
  • The BRCT domains recognize and bind phosphorylated pSXXF motif on proteins. The interaction with the phosphorylated pSXXF motif of ABRAXAS1, recruits BRCA1 at DNA damage sites.
Domain:
  • The BRCT domains recognize and bind phosphorylated pSXXF motif on proteins. The interaction with the phosphorylated pSXXF motif of ABRAXAS1, recruits BRCA1 at DNA damage sites.
  • The RING-type zinc finger domain interacts with BAP1.
genes like me logo Genes that share domains with BRCA1: view

Function for BRCA1 Gene

Molecular function for BRCA1 Gene

GENATLAS Biochemistry:
nuclear cell cycle regulated phosphoprotein of breast epithelium,located at the centrosome during M phase,associating with RAD51 (RECA) at S phase of mitosis,putative negative regulator of cell growth (in a RB-dependent fashion),phosphorylated by ATM protein kinase in response to ionizing radiation induced DNA damage,then activating DNA repair through homologous recombination in cooperation with BRCA2,RAD51 and RAD52,P-BRCA,also complexing with RNA polymerase II holoenzyme,may also regulate transcription,recruiting CREBBP and interacting with components of the histone deacetylase complex,mediating ubiquitin-conjugating enzyme (E2)-dependent ubiquitination through the RING finger domain,induction of BRCA1 triggers JNK/SAPK (MAPK8) dependent apoptosis through induction of DDIT1 (GADD45)
UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot EnzymeRegulation:
The E3 ubiquitin-protein ligase activity is inhibited by phosphorylation by AURKA. Activity is increased by phosphatase treatment.
UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase that specifically mediates the formation of Lys-6-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule nucleation. Required for normal cell cycle progression from G2 to mitosis. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation. Contributes to homologous recombination repair (HRR) via its direct interaction with PALB2, fine-tunes recombinational repair partly through its modulatory role in the PALB2-dependent loading of BRCA2-RAD51 repair machinery at DNA breaks. Component of the BRCA1-RBBP8 complex which regulates CHEK1 activation and controls cell cycle G2/M checkpoints on DNA damage via BRCA1-mediated ubiquitination of RBBP8. Acts as a transcriptional activator (PubMed:20160719).

Enzyme Numbers (IUBMB) for BRCA1 Gene

Gene Ontology (GO) - Molecular Function for BRCA1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001105 RNA polymerase II transcription coactivator activity IMP 9662397
GO:0003677 DNA binding TAS,IEA 9662397
GO:0003684 damaged DNA binding IEA --
GO:0003713 transcription coactivator activity NAS 15572661
GO:0003723 RNA binding IDA 12419249
genes like me logo Genes that share ontologies with BRCA1: view

Phenotypes for BRCA1 Gene

MGI mutant phenotypes for BRCA1:
inferred from 21 alleles
GenomeRNAi human phenotypes for BRCA1:
genes like me logo Genes that share phenotypes with BRCA1: view

Human Phenotype Ontology for BRCA1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for BRCA1 Gene

MGI Knock Outs for BRCA1:

Animal Model Products

Clone Products

  • Addgene plasmids for BRCA1

No data available for Phenotypes From GWAS Catalog , Transcription Factor Targets and HOMER Transcription for BRCA1 Gene

Localization for BRCA1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for BRCA1 Gene

Nucleus. Chromosome. Cytoplasm. Note=Localizes at sites of DNA damage at double-strand breaks (DSBs); recruitment to DNA damage sites is mediated by ABRAXAS1 and the BRCA1-A complex (PubMed:26778126). Translocated to the cytoplasm during UV-induced apoptosis (PubMed:20160719). {ECO:0000269 PubMed:20160719, ECO:0000269 PubMed:26778126}.
Isoform 3: Cytoplasm.
Isoform 5: Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for BRCA1 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
nucleus 5
cytosol 4
mitochondrion 2
extracellular 1

Gene Ontology (GO) - Cellular Components for BRCA1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000151 ubiquitin ligase complex NAS 14976165
GO:0000793 condensed chromosome IEA --
GO:0000794 condensed nuclear chromosome IEA --
GO:0000800 lateral element IDA 9774970
GO:0005634 nucleus IEA,IDA 17525340
genes like me logo Genes that share ontologies with BRCA1: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for BRCA1 Gene

Pathways & Interactions for BRCA1 Gene

genes like me logo Genes that share pathways with BRCA1: view

UniProtKB/Swiss-Prot P38398-BRCA1_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

SIGNOR curated interactions for BRCA1 Gene

Activates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for BRCA1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000724 double-strand break repair via homologous recombination IDA 17349954
GO:0000729 DNA double-strand break processing TAS --
GO:0000731 DNA synthesis involved in DNA repair TAS --
GO:0000732 strand displacement TAS --
GO:0006260 DNA replication TAS --
genes like me logo Genes that share ontologies with BRCA1: view

Drugs & Compounds for BRCA1 Gene

(122) Drugs for BRCA1 Gene - From: PharmGKB, ClinicalTrials, DGIdb, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Olaparib Approved Pharma inhibitor, Biomarker, other PARP inhibitor, PARP Inhibitors, Other, Poly(ADPRIBOSE) polymerase (PARP) inhibitors 162
Rucaparib Approved, Investigational Pharma inhibitor, Biomarker, other PARP inhibitor, PARP Inhibitors, Other 23
Carboplatin Approved Pharma Biomarker Antitumor agent that forms platinum-DNA adducts., Platinum 2141
Cisplatin Approved Pharma Biomarker, inhibitor Inhibits DNA synthesis,chemotherapy drug, Potent pro-apoptotic anticancer agent; activates caspase-3, Platinum 2906
Docetaxel Approved May 1996, Investigational Pharma Microtubulin disassembly inhibitor, Tubulin and VEGF inhibitor, Taxanes 2040

(45) Additional Compounds for BRCA1 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with BRCA1: view

Transcripts for BRCA1 Gene

Unigene Clusters for BRCA1 Gene

Breast cancer 1, early onset:
Representative Sequences:

Clone Products

  • Addgene plasmids for BRCA1

Alternative Splicing Database (ASD) splice patterns (SP) for BRCA1 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b · 10c · 10d ^ 11 ^ 12 ^ 13 ^ 14 ^ 15a · 15b ^ 16a ·
SP1: - -
SP2: - -
SP3: - - -
SP4: - - - -
SP5: - - - - -
SP6:
SP7: - -
SP8:

ExUns: 16b ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23
SP1: -
SP2: -
SP3: -
SP4: -
SP5: -
SP6:
SP7:
SP8:

Relevant External Links for BRCA1 Gene

GeneLoc Exon Structure for
BRCA1
ECgene alternative splicing isoforms for
BRCA1

Expression for BRCA1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for BRCA1 Gene

Protein differential expression in normal tissues from HIPED for BRCA1 Gene

This gene is overexpressed in Bone (66.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for BRCA1 Gene



Protein tissue co-expression partners for BRCA1 Gene

NURSA nuclear receptor signaling pathways regulating expression of BRCA1 Gene:

BRCA1

SOURCE GeneReport for Unigene cluster for BRCA1 Gene:

Hs.194143

mRNA Expression by UniProt/SwissProt for BRCA1 Gene:

P38398-BRCA1_HUMAN
Tissue specificity: Isoform 1 and isoform 3 are widely expressed. Isoform 3 is reduced or absent in several breast and ovarian cancer cell lines.

Evidence on tissue expression from TISSUES for BRCA1 Gene

  • Nervous system(4.5)
  • Intestine(2.8)
  • Blood(2.3)
  • Kidney(2.3)
  • Lymph node(2.2)
  • Adrenal gland(2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for BRCA1 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • digestive
  • endocrine
  • integumentary
  • nervous
  • reproductive
  • skeletal muscle
Regions:
Head and neck:
  • brain
  • cerebellum
  • head
Thorax:
  • breast
  • esophagus
Abdomen:
  • abdominal wall
  • intestine
  • large intestine
  • pancreas
  • stomach
Pelvis:
  • ovary
  • prostate
  • rectum
General:
  • spinal cord
genes like me logo Genes that share expression patterns with BRCA1: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for BRCA1 Gene

Orthologs for BRCA1 Gene

This gene was present in the common ancestor of chordates.

Orthologs for BRCA1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia BRCA1 33 34
  • 99.27 (n)
dog
(Canis familiaris)
Mammalia BRCA1 33 34
  • 84.14 (n)
cow
(Bos Taurus)
Mammalia BRCA1 33 34
  • 83.67 (n)
rat
(Rattus norvegicus)
Mammalia Brca1 33
  • 75.1 (n)
mouse
(Mus musculus)
Mammalia Brca1 33 16 34
  • 74.24 (n)
oppossum
(Monodelphis domestica)
Mammalia BRCA1 34