Free for academic non-profit institutions. Other users need a Commercial license

Aliases for EIF2AK1 Gene

Aliases for EIF2AK1 Gene

  • Eukaryotic Translation Initiation Factor 2 Alpha Kinase 1 2 3 5
  • Heme-Regulated Eukaryotic Initiation Factor EIF-2-Alpha Kinase 3 4
  • Hemin-Sensitive Initiation Factor 2-Alpha Kinase 3 4
  • Heme Regulated Initiation Factor 2 Alpha Kinase 2 3
  • Heme-Controlled Repressor 3 4
  • Heme-Regulated Inhibitor 3 4
  • EC 2.7.11.1 4 56
  • HCR 3 4
  • HRI 3 4
  • Eukaryotic Translation Initiation Factor 2-Alpha Kinase 1 3
  • Heme Sensitive Initiation Factor 2a Kinase 3
  • Heme-Regulated Repressor 3
  • EC 2.7.11 56
  • KIAA1369 4

External Ids for EIF2AK1 Gene

Previous GeneCards Identifiers for EIF2AK1 Gene

  • GC07M005836
  • GC07M006028
  • GC07M006029
  • GC07M006061

Summaries for EIF2AK1 Gene

Entrez Gene Summary for EIF2AK1 Gene

  • The protein encoded by this gene acts at the level of translation initiation to downregulate protein synthesis in response to stress. The encoded protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

GeneCards Summary for EIF2AK1 Gene

EIF2AK1 (Eukaryotic Translation Initiation Factor 2 Alpha Kinase 1) is a Protein Coding gene. Among its related pathways are Regulation of lipid metabolism Insulin signaling-generic cascades and Translation Factors. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and protein kinase activity. An important paralog of this gene is EIF2AK3.

UniProtKB/Swiss-Prot for EIF2AK1 Gene

  • Inhibits protein synthesis at the translation initiation level, in response to various stress conditions, including oxidative stress, heme deficiency, osmotic shock and heat shock. Exerts its function through the phosphorylation of EIF2S1 at Ser-48 and Ser-51, thus preventing its recycling. Binds hemin forming a 1:1 complex through a cysteine thiolate and histidine nitrogenous coordination. This binding occurs with moderate affinity, allowing it to sense the heme concentration within the cell. Thanks to this unique heme-sensing capacity, plays a crucial role to shut off protein synthesis during acute heme-deficient conditions. In red blood cells (RBCs), controls hemoglobin synthesis ensuring a coordinated regulation of the synthesis of its heme and globin moieties. Thus plays an essential protective role for RBC survival in anemias of iron deficiency. Similarly, in hepatocytes, involved in heme-mediated translational control of CYP2B and CYP3A and possibly other hepatic P450 cytochromes. May also contain ER stress during acute heme-deficient conditions (By similarity).

Gene Wiki entry for EIF2AK1 Gene

Additional gene information for EIF2AK1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for EIF2AK1 Gene

Genomics for EIF2AK1 Gene

GeneHancer (GH) Regulatory Elements for EIF2AK1 Gene

Promoters and enhancers for EIF2AK1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH07I006055 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE 576.3 +1.5 1544 4.3 HDGF PKNOX1 SMAD1 FOXA2 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 EIF2AK1 GC07P006057 RNU6-218P CCZ1
GH07I006007 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 21.8 +48.6 48604 6.3 CLOCK MLX DMAP1 YY1 SLC30A9 E2F8 ZNF143 SP3 NFYC PPARGC1A PMS2 AIMP2 USP42 ANKRD61 C7orf26 EIF2AK1 ZNF316 RNF216 ZNF12 PMS2CL
GH07I006103 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE 19.5 -46.2 -46205 3.8 HDGF PKNOX1 CLOCK FOXA2 SMAD1 ARNT ZFP64 ARID4B SIN3A FEZF1 USP42 GC07M006104 EIF2AK1 ZNF12 C7orf26 ZNF316 RNU6-218P TNRC18 PMS2 CCZ1
GH07I006014 Enhancer 1.1 Ensembl ENCODE 25.2 +42.8 42837 3.1 PKNOX1 IRF4 ZNF766 ATF7 RUNX3 RXRA CAVIN1 JUNB ZNF592 MEF2D SNORA80D EIF2AK1 ZNF12 RBAK PMS2 C7orf26 TNRC18 ZNF316 USP42 PMS2CL
GH07I006025 Enhancer 0.9 Ensembl ENCODE 29.5 +32.5 32472 2.7 CTCF TFAP4 SAP130 ARID4B EBF1 ZIC2 RAD21 ZNF121 ZNF766 GLIS2 EIF2AK1 RNU6-218P ZDHHC4 ANKRD61 SNORA80D
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around EIF2AK1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the EIF2AK1 gene promoter:

Genomic Locations for EIF2AK1 Gene

Genomic Locations for EIF2AK1 Gene
chr7:6,022,244-6,059,230
(GRCh38/hg38)
Size:
36,987 bases
Orientation:
Minus strand
chr7:6,061,878-6,098,861
(GRCh37/hg19)

Genomic View for EIF2AK1 Gene

Genes around EIF2AK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
EIF2AK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for EIF2AK1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for EIF2AK1 Gene

Proteins for EIF2AK1 Gene

  • Protein details for EIF2AK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9BQI3-E2AK1_HUMAN
    Recommended name:
    Eukaryotic translation initiation factor 2-alpha kinase 1
    Protein Accession:
    Q9BQI3
    Secondary Accessions:
    • A8K2R2
    • Q549K6
    • Q8NBW3
    • Q9HC02
    • Q9NYE0
    • Q9P0V6
    • Q9P1J5
    • Q9P2H8
    • Q9UHG4

    Protein attributes for EIF2AK1 Gene

    Size:
    630 amino acids
    Molecular mass:
    71106 Da
    Quaternary structure:
    • Synthesized in an inactive form that binds to the N-terminal domain of CDC37. Has to be associated with a multiprotein complex containing Hsp90, CDC37 and PPP5C for maturation and activation by autophosphorylation. The phosphatase PPP5C modulates this activation. Forms oligomers. Has been reported as a non-covalently bound homodimer, as well as a hexamer in the absence of hemin. Converted to an inactive disulfide linked homodimer in the presence of hemin (By similarity).
    Miscellaneous:
    • Can bind 1 molecules of heme per polypeptide chain.
    SequenceCaution:
    • Sequence=AAF70289.1; Type=Frameshift; Positions=24, 26, 33; Evidence={ECO:0000305}; Sequence=AAF71057.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=BAA92607.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Alternative splice isoforms for EIF2AK1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for EIF2AK1 Gene

Selected DME Specific Peptides for EIF2AK1 Gene

Q9BQI3:
  • YHLMLHIQMQLCELSLWDWI
  • CMKVLREVKVLAGLQHPNIVGYHTAWIEHVHV
  • VANQLLLVSLLEHLSHVHEPNPL
  • VATKIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQV
  • KVRNKLDG
  • THTSRVGTCLYASPEQLEGS
  • YDESDVPAE
  • EAQTSRYLNEFEE
  • LGKGGYG
  • ERVRQDPC
  • VHRDLKP
  • QKIRSRE
  • IVHRDLK

Post-translational modifications for EIF2AK1 Gene

  • Activated by autophosphorylation; phosphorylated predominantly on serine and threonine residues, but also on tyrosine residues. Autophosphorylation at Thr-488 is required for kinase activation. The active autophosphorylated form apparently is largely refractory to cellular heme fluctuations (By similarity).
  • Ubiquitination at posLast=472472
  • Modification sites at PhosphoSitePlus

Other Protein References for EIF2AK1 Gene

Domains & Families for EIF2AK1 Gene

Gene Families for EIF2AK1 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted secreted proteins

Protein Domains for EIF2AK1 Gene

Graphical View of Domain Structure for InterPro Entry

Q9BQI3

UniProtKB/Swiss-Prot:

E2AK1_HUMAN :
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.
Family:
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.
genes like me logo Genes that share domains with EIF2AK1: view

Function for EIF2AK1 Gene

Molecular function for EIF2AK1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Induced by acute heme depletion, that not only increases EIF2AK1 protein levels, but also stimulates kinase activity by autophosphorylation. Inhibited by the heme-degradation products biliverdin and bilirubin. Induced by oxidative stress generated by arsenite treatment. Binding of nitric oxide (NO) to the heme iron in the N-terminal heme-binding domain activates the kinase activity, while binding of carbon monoxide (CO) suppresses kinase activity (By similarity).
UniProtKB/Swiss-Prot Function:
Inhibits protein synthesis at the translation initiation level, in response to various stress conditions, including oxidative stress, heme deficiency, osmotic shock and heat shock. Exerts its function through the phosphorylation of EIF2S1 at Ser-48 and Ser-51, thus preventing its recycling. Binds hemin forming a 1:1 complex through a cysteine thiolate and histidine nitrogenous coordination. This binding occurs with moderate affinity, allowing it to sense the heme concentration within the cell. Thanks to this unique heme-sensing capacity, plays a crucial role to shut off protein synthesis during acute heme-deficient conditions. In red blood cells (RBCs), controls hemoglobin synthesis ensuring a coordinated regulation of the synthesis of its heme and globin moieties. Thus plays an essential protective role for RBC survival in anemias of iron deficiency. Similarly, in hepatocytes, involved in heme-mediated translational control of CYP2B and CYP3A and possibly other hepatic P450 cytochromes. May also contain ER stress during acute heme-deficient conditions (By similarity).

Enzyme Numbers (IUBMB) for EIF2AK1 Gene

Phenotypes From GWAS Catalog for EIF2AK1 Gene

Gene Ontology (GO) - Molecular Function for EIF2AK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003743 translation initiation factor activity IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0004694 eukaryotic translation initiation factor 2alpha kinase activity IEA,IDA 11036079
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with EIF2AK1: view
genes like me logo Genes that share phenotypes with EIF2AK1: view

Animal Models for EIF2AK1 Gene

MGI Knock Outs for EIF2AK1:

Animal Model Products

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for EIF2AK1 Gene

Localization for EIF2AK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for EIF2AK1 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for EIF2AK1 gene
Compartment Confidence
nucleus 3
cytosol 3
endoplasmic reticulum 2

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleus (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for EIF2AK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
genes like me logo Genes that share ontologies with EIF2AK1: view

Pathways & Interactions for EIF2AK1 Gene

genes like me logo Genes that share pathways with EIF2AK1: view

Pathways by source for EIF2AK1 Gene

1 BioSystems pathway for EIF2AK1 Gene
1 GeneGo (Thomson Reuters) pathway for EIF2AK1 Gene
1 Qiagen pathway for EIF2AK1 Gene

SIGNOR curated interactions for EIF2AK1 Gene

Activates:
Inactivates:

Gene Ontology (GO) - Biological Process for EIF2AK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002526 acute inflammatory response IEA --
GO:0006413 translational initiation IEA --
GO:0006417 regulation of translation IEA --
GO:0006468 protein phosphorylation IEA --
GO:0006909 phagocytosis IEA --
genes like me logo Genes that share ontologies with EIF2AK1: view

Drugs & Compounds for EIF2AK1 Gene

(8) Drugs for EIF2AK1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carbon monoxide Approved, Investigational Pharma 132
Hemin Approved, Investigational Pharma 0
ATP Investigational Nutra Agonist 0
heme Pharma Agonist 0

(3) Additional Compounds for EIF2AK1 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Fe2+
  • Armco iron
  • Carbonyl iron
  • FE
  • Ferrovac e
  • Hematite
15438-31-0
genes like me logo Genes that share compounds with EIF2AK1: view

Transcripts for EIF2AK1 Gene

Unigene Clusters for EIF2AK1 Gene

Eukaryotic translation initiation factor 2-alpha kinase 1:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for EIF2AK1 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6 ^ 7 ^ 8a · 8b ^ 9a · 9b ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14a · 14b ^ 15 ^ 16a · 16b ^
SP1: - -
SP2: - -
SP3: -
SP4: -
SP5: - -
SP6: - - -
SP7: - -
SP8: - - - -
SP9: - -
SP10: - - - -
SP11: -
SP12:
SP13:

ExUns: 17a · 17b ^ 18a · 18b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:

Relevant External Links for EIF2AK1 Gene

GeneLoc Exon Structure for
EIF2AK1
ECgene alternative splicing isoforms for
EIF2AK1

Expression for EIF2AK1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for EIF2AK1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for EIF2AK1 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (57.2) and Fetal Liver (8.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for EIF2AK1 Gene



Protein tissue co-expression partners for EIF2AK1 Gene

NURSA nuclear receptor signaling pathways regulating expression of EIF2AK1 Gene:

EIF2AK1

SOURCE GeneReport for Unigene cluster for EIF2AK1 Gene:

Hs.520205

mRNA Expression by UniProt/SwissProt for EIF2AK1 Gene:

Q9BQI3-E2AK1_HUMAN
Tissue specificity: Expressed predominantly in erythroid cells. At much lower levels, expressed in hepatocytes (at protein level).

Evidence on tissue expression from TISSUES for EIF2AK1 Gene

  • Nervous system(4.9)
  • Skin(4.5)
  • Bone marrow(4.4)
  • Lung(3.7)
  • Intestine(3.5)
  • Liver(2.8)
  • Pancreas(2.8)
  • Blood(2.4)
  • Kidney(2.4)
  • Eye(2.2)
genes like me logo Genes that share expression patterns with EIF2AK1: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for EIF2AK1 Gene

Orthologs for EIF2AK1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for EIF2AK1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia EIF2AK1 33 34
  • 99.31 (n)
dog
(Canis familiaris)
Mammalia EIF2AK1 33 34
  • 87.06 (n)
cow
(Bos Taurus)
Mammalia EIF2AK1 33 34
  • 84 (n)
mouse
(Mus musculus)
Mammalia Eif2ak1 33 16 34
  • 83.44 (n)
rat
(Rattus norvegicus)
Mammalia Eif2ak1 33
  • 82.18 (n)
oppossum
(Monodelphis domestica)
Mammalia EIF2AK1 34
  • 68 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia EIF2AK1 34
  • 59 (a)
OneToOne
chicken
(Gallus gallus)
Aves EIF2AK1 33 34
  • 63.1 (n)
lizard
(Anolis carolinensis)
Reptilia EIF2AK1 34
  • 48 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia eif2ak1 33
  • 58.19 (n)
zebrafish
(Danio rerio)
Actinopterygii eif2ak1 33 34
  • 54.79 (n)
worm
(Caenorhabditis elegans)
Secernentea gcn-2 34
  • 8 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes GCN2 34
  • 9 (a)
OneToMany
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes hri1 33
  • 45.79 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 30 (a)
OneToOne
Species where no ortholog for EIF2AK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for EIF2AK1 Gene

ENSEMBL:
Gene Tree for EIF2AK1 (if available)
TreeFam:
Gene Tree for EIF2AK1 (if available)

Paralogs for EIF2AK1 Gene

Paralogs for EIF2AK1 Gene

(3) SIMAP similar genes for EIF2AK1 Gene using alignment to 5 proteins:

genes like me logo Genes that share paralogs with EIF2AK1: view

Variants for EIF2AK1 Gene

Sequence variations from dbSNP and Humsavar for EIF2AK1 Gene

SNP ID Clin Chr 07 pos Variation AA Info Type
rs869312968 pathogenic, Inborn genetic diseases 6,023,301(-) A/G/T 3_prime_UTR_variant
VAR_040471 A lung adenocarcinoma sample p.Gly202Ser
rs1000074241 -- 6,047,059(-) G/A coding_sequence_variant, missense_variant
rs1000337216 -- 6,027,693(-) A/T intron_variant
rs1000339927 -- 6,052,555(-) A/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for EIF2AK1 Gene

Variant ID Type Subtype PubMed ID
esv1385792 CNV deletion 17803354
esv1914954 OTHER inversion 16254605
esv2658842 CNV deletion 23128226
esv3891031 CNV loss 25118596
esv988101 CNV deletion 20482838
nsv1018388 CNV gain 25217958
nsv1034916 CNV gain 25217958
nsv1114913 CNV deletion 24896259
nsv1124167 CNV deletion 24896259
nsv1146112 CNV insertion 26484159
nsv436904 CNV insertion 17901297
nsv471823 CNV novel sequence insertion 20440878
nsv605998 CNV loss 21841781
nsv7392 OTHER inversion 18451855
nsv830894 CNV loss 17160897

Variation tolerance for EIF2AK1 Gene

Residual Variation Intolerance Score: 28.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 6.94; 79.77% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for EIF2AK1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
EIF2AK1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for EIF2AK1 Gene

Disorders for EIF2AK1 Gene

Additional Disease Information for EIF2AK1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for EIF2AK1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for EIF2AK1 Gene

Publications for EIF2AK1 Gene

  1. Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. (PMID: 11036079) Shao J … Matts RL (The Journal of biological chemistry 2001) 3 4 22 58
  2. Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10718198) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2000) 2 3 4 58
  3. Cloning of hHRI, human heme-regulated eukaryotic initiation factor 2alpha kinase: down-regulated in epithelial ovarian cancers. (PMID: 11101152) Hwang SY … Kim JC (Molecules and cells 2000) 3 4 22 58
  4. Regulation of protein synthesis by heme-regulated eIF-2 alpha kinase. (PMID: 7709427) Chen JJ … London IM (Trends in biochemical sciences 1995) 2 3 22 58
  5. Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals. (PMID: 19851296) Oguri M … Yamada Y (American journal of hypertension 2010) 3 44 58

Products for EIF2AK1 Gene

Sources for EIF2AK1 Gene

Content
Loading form....