Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PARP1 Gene

Aliases for PARP1 Gene

  • Poly(ADP-Ribose) Polymerase 1 2 3 5
  • ADP-Ribosyltransferase (NAD+; Poly (ADP-Ribose) Polymerase) 2 3
  • ADP-Ribosyltransferase Diphtheria Toxin-Like 1 3 4
  • Poly (ADP-Ribose) Polymerase Family, Member 1 2 3
  • NAD(+) ADP-Ribosyltransferase 1 3 4
  • Poly[ADP-Ribose] Synthase 1 3 4
  • EC 2.4.2.30 4 56
  • ADPRT 1 3 4
  • PARP-1 3 4
  • ADPRT 3 4
  • ARTD1 3 4
  • PPOL 3 4
  • Poly [ADP-Ribose] Polymerase 1 3
  • ADP-Ribosyltransferase NAD(+) 3
  • Poly(ADP-Ribosyl)Transferase 3
  • Poly(ADP-Ribose) Synthetase 3
  • PADPRT-1 3
  • EC 2.4.2 56
  • ADPRT1 3
  • PARP 3

External Ids for PARP1 Gene

Previous HGNC Symbols for PARP1 Gene

  • PPOL
  • ADPRT

Previous GeneCards Identifiers for PARP1 Gene

  • GC01M222855
  • GC01M224615
  • GC01M226548
  • GC01M197065
  • GC01M224102

Summaries for PARP1 Gene

Entrez Gene Summary for PARP1 Gene

  • This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. [provided by RefSeq, Jul 2008]

GeneCards Summary for PARP1 Gene

PARP1 (Poly(ADP-Ribose) Polymerase 1) is a Protein Coding gene. Diseases associated with PARP1 include Diphtheria and Hemorrhagic Cystitis. Among its related pathways are SUMOylation and Telomere C-strand (Lagging Strand) Synthesis. Gene Ontology (GO) annotations related to this gene include protein kinase binding. An important paralog of this gene is PARP2.

UniProtKB/Swiss-Prot for PARP1 Gene

  • Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks (PubMed:17177976, PubMed:18172500, PubMed:19344625, PubMed:19661379, PubMed:23230272). Mediates the poly(ADP-ribosyl)ation of APLF and CHFR (PubMed:17396150). Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. With EEF1A1 and TXK, forms a complex that acts as a T-helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production (PubMed:17177976). Required for PARP9 and DTX3L recruitment to DNA damage sites (PubMed:23230272). PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites (PubMed:23230272). Mediates serine ADP-ribosylation of target proteins following interaction with HPF1; HPF1 conferring serine specificity (PubMed:28190768). Mediates the poly(ADP-ribosyl)ation of histones in a HPF1-dependent manner (PubMed:27067600). Involved in the synthesis of ATP in the nucleus, together with NMNAT1, PARG and NUDT5 (PubMed:27257257). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (PubMed:27257257).

Tocris Summary for PARP1 Gene

  • Poly (ADP-ribose) polymerase (PARP) catalyzes the post-translational modification of proteins by the addition of multiple ADP-ribose moieties. PARP transfers ADP-ribose from nicotinamide dinucleotide (NAD) to Glu/Asp residues on the substrate protein.

Gene Wiki entry for PARP1 Gene

Additional gene information for PARP1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PARP1 Gene

Genomics for PARP1 Gene

GeneHancer (GH) Regulatory Elements for PARP1 Gene

Promoters and enhancers for PARP1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01I226402 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE 564.3 +2.5 2475 6.6 HDGF PKNOX1 MLX ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 PARP1 CDC42BPA ACBD3-AS1 LINC01703 STUM MIXL1 ACBD3 PSEN2 LOC101060016
GH01I226348 Enhancer 1 Ensembl ENCODE 11.2 +57.9 57864 2.7 HDAC1 RB1 NFIB TCF12 ZNF121 ZNF766 GATA2 EGR1 RUNX3 EGR2 ACBD3-AS1 ACBD3 LIN9 PARP1 MIXL1 LOC101060016
GH01I226479 Enhancer 0.9 ENCODE 10.4 -71.5 -71545 0 CLOCK FOXA2 NEUROD1 FEZF1 FOS TSHZ1 PPARG KAT8 MIER3 ZSCAN16 ACBD3 H3F3A STUM PARP1 CDKN2AIPNLP1 RN7SKP165
GH01I226197 Enhancer 0.8 ENCODE 9.9 +210.9 210945 0.2 HDGF RB1 ARID4B ZNF76 ZNF2 ZNF48 RAD21 ZNF335 ZNF143 CREM GC01M226196 MIXL1 ACBD3-AS1 LIN9 PARP1 LOC101927247
GH01I226370 Enhancer 0.5 ENCODE 15.4 +37.2 37232 1.6 ZFP69B ZNF692 EBF1 ETV6 ZBTB20 PARP1 ACBD3-AS1 LIN9 LOC101060016
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around PARP1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PARP1 gene promoter:

Genomic Locations for PARP1 Gene

Genomic Locations for PARP1 Gene
chr1:226,360,691-226,408,100
(GRCh38/hg38)
Size:
47,410 bases
Orientation:
Minus strand
chr1:226,548,392-226,595,801
(GRCh37/hg19)

Genomic View for PARP1 Gene

Genes around PARP1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PARP1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PARP1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PARP1 Gene

Proteins for PARP1 Gene

  • Protein details for PARP1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P09874-PARP1_HUMAN
    Recommended name:
    Poly [ADP-ribose] polymerase 1
    Protein Accession:
    P09874
    Secondary Accessions:
    • B1ANJ4
    • Q8IUZ9

    Protein attributes for PARP1 Gene

    Size:
    1014 amino acids
    Molecular mass:
    113084 Da
    Quaternary structure:
    • Component of a base excision repair (BER) complex, containing at least XRCC1, PARP2, POLB and LRIG3. Homo- and heterodimer with PARP2. Interacts with APTX (PubMed:15044383). Interacts with PARP3. Interacts with SRY (PubMed:16904257). The SWAP complex consists of NPM1, NCL, PARP1 and SWAP70. Interacts with TIAM2 (By similarity). Interacts (when poly-ADP-ribosylated) with CHD1L (PubMed:19661379). Interacts with the DNA polymerase alpha catalytic subunit POLA1; this interaction functions as part of the control of replication fork progression (PubMed:9518481). Interacts with EEF1A1 and TXK (PubMed:17177976). Interacts with RNF4 (PubMed:19779455). Interacts with RNF146 (PubMed:21799911). Interacts with ZNF423 (PubMed:22863007). Interacts with SNAI1 (via zinc fingers); the interaction requires SNAI1 to be poly-ADP-ribosylated and non-phosphorylated (active) by GSK3B (PubMed:21577210). Interacts (when poly-ADP-ribosylated) with PARP9 (PubMed:23230272). Interacts with NR4A3; activates PARP1 by improving acetylation of PARP1 and suppressing the interaction between PARP1 and SIRT1 (By similarity). Interacts (via catalytic domain) with PUM3; the interaction inhibits the poly(ADP-ribosyl)ation activity of PARP1 and the degradation of PARP1 by CASP3 following genotoxic stress (PubMed:21266351). Interacts (via the PARP catalytic domain) with HPF1 (PubMed:27067600, PubMed:28190768). Interacts with ZNF365 (PubMed:23966166). Interacts with RRP1B (PubMed:19710015).
    Miscellaneous:
    • The ADP-D-ribosyl group of NAD(+) is transferred to an acceptor carboxyl group on a histone or the enzyme itself, and further ADP-ribosyl groups are transferred to the 2-position of the terminal adenosine moiety, building up a polymer with an average chain length of 20-30 units.

    Three dimensional structures from OCA and Proteopedia for PARP1 Gene

neXtProt entry for PARP1 Gene

Selected DME Specific Peptides for PARP1 Gene

P09874:
  • LYEEKTGN
  • YWIFRSWGR
  • MIEKLGG
  • DAYYCTGD
  • YVKNTHA
  • YSASQLKGF
  • GKGIYFA
  • RQIQAAYSILSEVQQ
  • QRYKPFKQLHNR
  • FYTLIPHDFGMKKPPLLNN
  • SVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYE
  • NYEKLKT
  • SPMFDGK
  • QQVPSGE
  • DEVAKKKS
  • DFAAEYAKSNRSTCKGC
  • EIDLQKMPLGKLSKRQIQ
  • VPSGESAILDRVADGM
  • KRKGDEVDG
  • KTGNAWHS
  • LLWHGSR
  • GTNSYYKLQL
  • YNEYIVY
  • KTDIKVV
  • WVTPKEF
  • NRRLLWHGS
  • ESIPKDS
  • NMKILTLGKLS
  • GTVIGSNKLEQMPSKE
  • THNAYDL
  • PQLGMIDRWYHP
  • KLPKGKHSVKGLG
  • KKQDRIFPPE
  • AVDPDSGLE
  • NFTKYPKKFYPLEIDYGQ
  • SPWGAEVK
  • GFSELRWDDQQ

Post-translational modifications for PARP1 Gene

  • Phosphorylated by PRKDC and TXK.
  • Poly-ADP-ribosylated by PARP2; poly-ADP-ribosylation mediates the recruitment of CHD1L to DNA damage sites (PubMed:19661379). ADP-ribosylated on serine by autocatalysis; serine ADP-ribosylation takes place following interaction with HPF1 (PubMed:28190768).
  • S-nitrosylated, leading to inhibit transcription regulation activity.
  • Ubiquitination at Lys119, Lys165, isoforms=239, Lys269, isoforms=320, Lys337, Lys394, Lys400, Lys528, isoforms=551, isoforms=564, Lys579, Lys600, and isoforms=637
  • Modification sites at PhosphoSitePlus

Other Protein References for PARP1 Gene

Antibody Products

Domains & Families for PARP1 Gene

Gene Families for PARP1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for PARP1 Gene

Graphical View of Domain Structure for InterPro Entry

genes like me logo Genes that share domains with PARP1: view

No data available for UniProtKB/Swiss-Prot for PARP1 Gene

Function for PARP1 Gene

Molecular function for PARP1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
NAD(+) + (ADP-D-ribosyl)(n)-acceptor = nicotinamide + (ADP-D-ribosyl)(n+1)-acceptor.
UniProtKB/Swiss-Prot Function:
Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks (PubMed:17177976, PubMed:18172500, PubMed:19344625, PubMed:19661379, PubMed:23230272). Mediates the poly(ADP-ribosyl)ation of APLF and CHFR (PubMed:17396150). Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. With EEF1A1 and TXK, forms a complex that acts as a T-helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-gamma to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production (PubMed:17177976). Required for PARP9 and DTX3L recruitment to DNA damage sites (PubMed:23230272). PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites (PubMed:23230272). Mediates serine ADP-ribosylation of target proteins following interaction with HPF1; HPF1 conferring serine specificity (PubMed:28190768). Mediates the poly(ADP-ribosyl)ation of histones in a HPF1-dependent manner (PubMed:27067600). Involved in the synthesis of ATP in the nucleus, together with NMNAT1, PARG and NUDT5 (PubMed:27257257). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (PubMed:27257257).

Enzyme Numbers (IUBMB) for PARP1 Gene

Phenotypes From GWAS Catalog for PARP1 Gene

Gene Ontology (GO) - Molecular Function for PARP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000977 RNA polymerase II regulatory region sequence-specific DNA binding IDA 11112786
GO:0001228 transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 11112786
GO:0003677 DNA binding TAS,IEA 2513174
GO:0003723 RNA binding IDA,HDA 22658674
GO:0003910 DNA ligase (ATP) activity IBA --
genes like me logo Genes that share ontologies with PARP1: view
genes like me logo Genes that share phenotypes with PARP1: view

Animal Models for PARP1 Gene

MGI Knock Outs for PARP1:

Animal Model Products

  • Taconic Biosciences Mouse Models for PARP1

miRNA for PARP1 Gene

miRTarBase miRNAs that target PARP1

Clone Products

  • Addgene plasmids for PARP1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PARP1 Gene

Localization for PARP1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PARP1 Gene

Nucleus. Nucleus, nucleolus. Note=Localizes at sites of DNA damage. {ECO:0000269 PubMed:23230272}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PARP1 gene
Compartment Confidence
mitochondrion 5
nucleus 5
cytosol 3
plasma membrane 2
extracellular 2
cytoskeleton 2
endoplasmic reticulum 2
lysosome 2
golgi apparatus 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PARP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000784 nuclear chromosome, telomeric region IDA,HDA 19135898
GO:0005634 nucleus TAS,IDA 17177976
GO:0005635 nuclear envelope IDA 9518481
GO:0005654 nucleoplasm TAS --
GO:0005667 transcription factor complex IDA 19303849
genes like me logo Genes that share ontologies with PARP1: view

Pathways & Interactions for PARP1 Gene

genes like me logo Genes that share pathways with PARP1: view

SIGNOR curated interactions for PARP1 Gene

Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for PARP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II TAS --
GO:0000715 nucleotide-excision repair, DNA damage recognition TAS --
GO:0000717 nucleotide-excision repair, DNA duplex unwinding TAS --
GO:0000723 telomere maintenance TAS 25749521
GO:0000724 double-strand break repair via homologous recombination TAS --
genes like me logo Genes that share ontologies with PARP1: view

Drugs & Compounds for PARP1 Gene

(119) Drugs for PARP1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, FDA Approved Drugs, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Rucaparib Approved, Investigational Pharma Target, antagonist, inhibitor, Biomarker, other PARP inhibitor, PARP Inhibitors, Other 23
Nicotinamide Approved, Investigational Nutra Target, binder 942,946
Niraparib Approved, Investigational Pharma Target, antagonist, inhibitor, Biomarker PARP inhibitor, PARP Inhibitors 33
Olaparib Approved Pharma Target, inhibitor, Biomarker, other PARP inhibitor, PARP Inhibitors, Other, Poly(ADPRIBOSE) polymerase (PARP) inhibitors 162
Theophylline Approved Pharma Antagonist, Target 67

(69) Additional Compounds for PARP1 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs

(3) Tocris Compounds for PARP1 Gene

Compound Action Cas Number
3-Aminobenzamide PARP inhibitor 3544-24-9
4-HQN PARP inhibitor 491-36-1
NU 1025 Potent PARP inhibitor 90417-38-2

(28) ApexBio Compounds for PARP1 Gene

Compound Action Cas Number
4-HQN PARP inhibitor 491-36-1
A-966492 PARP-1/-2 inhibitor, highly potent 934162-61-5
ABT-888 (Veliparib) Potent PARP inhibitor 912444-00-9
AG-14361 Potent PARP1 inhibitor 328543-09-5
AZD2461 Novel PARP inhibitor 1174043-16-3
BMN 673 Potent PARP inhibitor 1207456-01-6
BMN-673 8R,9S PARP inhibitor 1207456-00-5
BYK 204165 PARP-1 inhibitor,potent and selective 1104546-89-5
BYK 49187 Potent PARP-1/PARP-2 inhibitor 163120-31-8
Cordycepin 73-03-0
DR 2313 PARP inhibitor 284028-90-6
EB 47 Potent PARP-1 inhibitor 1190332-25-2
Iniparib (BSI-201) PARP1 inhibitor,intravenously adminsitered 160003-66-7
INO-1001 Potent PARP inhibitor 3544-24-9
JW 55 PARP domain inhibitor 664993-53-7
ME0328 PARP inhibitor,potent and selective 1445251-22-8
MK-4827 PARP-1/-2 inhibitor,potent and selective 1038915-60-4
MK-4827 hydrochloride PARP1/PARP2 inhibitor 1038915-64-8
MK-4827 Racemate 1038915-75-1
MK-4827 tosylate PARP1/PARP2 inhibitor 1038915-73-9
Olaparib (AZD2281, Ku-0059436) Potent PARP1/PARP2 inhibitor 763113-22-0
PJ34 PARP-l inhibitor 344458-19-1
PJ34 hydrochloride PARP inhibitor,potent and cell-permeable 344458-15-7
Rucaparib (AG-014699,PF-01367338) Potent PARP inhibitor 459868-92-9
Rucaparib (free base) Potent PARP inhibitor 283173-50-2
UPF 1069 Selective PARP2 inhibitor 1048371-03-4
Veliparib dihydrochloride PARP-1/PARP-2 inhibitor 912445-05-7
WIKI4 Inhibitor of Wnt/ß-Catenin signaling and tankyrase 838818-26-1
genes like me logo Genes that share compounds with PARP1: view

Drug Products

Transcripts for PARP1 Gene

Unigene Clusters for PARP1 Gene

Poly (ADP-ribose) polymerase 1:
Representative Sequences:

Clone Products

  • Addgene plasmids for PARP1

Alternative Splicing Database (ASD) splice patterns (SP) for PARP1 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b ^ 17a · 17b ^ 18a · 18b ^
SP1: - - -
SP2: -
SP3:
SP4: - - -
SP5: -
SP6:
SP7:

ExUns: 19a · 19b ^ 20a · 20b ^ 21a · 21b ^ 22 ^ 23 ^ 24a · 24b
SP1: -
SP2: - -
SP3:
SP4:
SP5:
SP6:
SP7:

Relevant External Links for PARP1 Gene

GeneLoc Exon Structure for
PARP1
ECgene alternative splicing isoforms for
PARP1

Expression for PARP1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PARP1 Gene

Protein differential expression in normal tissues from HIPED for PARP1 Gene

This gene is overexpressed in Lymph node (10.9), Tlymphocyte (9.9), and Peripheral blood mononuclear cells (7.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PARP1 Gene



Protein tissue co-expression partners for PARP1 Gene

NURSA nuclear receptor signaling pathways regulating expression of PARP1 Gene:

PARP1

SOURCE GeneReport for Unigene cluster for PARP1 Gene:

Hs.177766

Evidence on tissue expression from TISSUES for PARP1 Gene

  • Nervous system(5)
  • Liver(4.7)
  • Intestine(4)
  • Lung(4)
  • Eye(3.7)
  • Skin(3.7)
  • Pancreas(3.6)
  • Heart(3.2)
  • Blood(3)
  • Adrenal gland(2.9)
  • Kidney(2.9)
  • Muscle(2.8)
  • Lymph node(2.6)
  • Spleen(2.6)
  • Bone marrow(2.4)
  • Stomach(2.3)
  • Thyroid gland(2)
genes like me logo Genes that share expression patterns with PARP1: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PARP1 Gene

Orthologs for PARP1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PARP1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PARP1 33 34
  • 99.18 (n)
dog
(Canis familiaris)
Mammalia PARP1 33 34
  • 88.41 (n)
cow
(Bos Taurus)
Mammalia PARP1 33 34
  • 88.38 (n)
mouse
(Mus musculus)
Mammalia Parp1 33 16 34
  • 86.48 (n)
rat
(Rattus norvegicus)
Mammalia Parp1 33
  • 86.11 (n)
oppossum
(Monodelphis domestica)
Mammalia PARP1 34
  • 85 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PARP1 34
  • 83 (a)
OneToOne
chicken
(Gallus gallus)
Aves PARP1 33 34
  • 75.17 (n)
lizard
(Anolis carolinensis)
Reptilia PARP1 34
  • 77 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia parp1 33
  • 71.98 (n)
African clawed frog
(Xenopus laevis)
Amphibia PARP 33
zebrafish
(Danio rerio)
Actinopterygii parp1 33 34
  • 69.45 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP003230 33
  • 53.1 (n)
fruit fly
(Drosophila melanogaster)
Insecta Parp 33 34
  • 49.48 (n)
worm
(Caenorhabditis elegans)
Secernentea pme-1 33 34
  • 48.15 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons PARP1 33
  • 50.21 (n)
rice
(Oryza sativa)
Liliopsida Os07g0413700 33
  • 51.72 (n)
Os.31900 33
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 63 (a)
OneToOne
Species where no ortholog for PARP1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PARP1 Gene

ENSEMBL:
Gene Tree for PARP1 (if available)
TreeFam:
Gene Tree for PARP1 (if available)

Paralogs for PARP1 Gene

Paralogs for PARP1 Gene

(2) SIMAP similar genes for PARP1 Gene using alignment to 5 proteins:

Pseudogenes.org Pseudogenes for PARP1 Gene

genes like me logo Genes that share paralogs with PARP1: view

Variants for PARP1 Gene

Sequence variations from dbSNP and Humsavar for PARP1 Gene

SNP ID Clin Chr 01 pos Variation AA Info Type
VAR_035852 A breast cancer sample p.Glu488Val
rs1000032633 -- 226,402,145(-) T/C intron_variant
rs1000033 -- 226,392,686(-) T/G intron_variant
rs1000045025 -- 226,400,184(-) C/T intron_variant
rs1000106754 -- 226,409,711(-) T/G upstream_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for PARP1 Gene

Variant ID Type Subtype PubMed ID
nsv527874 CNV loss 19592680
nsv832770 CNV loss 17160897
nsv832781 CNV gain 17160897

Variation tolerance for PARP1 Gene

Residual Variation Intolerance Score: 17.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 10.61; 91.31% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PARP1 Gene

Human Gene Mutation Database (HGMD)
PARP1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PARP1

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PARP1 Gene

Disorders for PARP1 Gene

MalaCards: The human disease database

(37) MalaCards diseases for PARP1 Gene - From: HGMD, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
diphtheria
  • corynebacterium infection
hemorrhagic cystitis
xeroderma pigmentosum, complementation group a
  • xpa
tetraploidy
  • tetraploidy syndrome
pellagra
  • niacin deficiency
- elite association - COSMIC cancer census association via MalaCards
Search PARP1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for PARP1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with PARP1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PARP1 Gene

Publications for PARP1 Gene

  1. Analysis of poly(ADP-ribose) polymerase-1 (PARP1) gene alteration in human germ cell tumor cell lines. (PMID: 20113831) Ogino H … Masutani M (Cancer genetics and cytogenetics 2010) 3 22 44 58
  2. Influence of PARP-1 polymorphisms in patients after traumatic brain injury. (PMID: 19925161) Sarnaik AA … Clark RS (Journal of neurotrauma 2010) 3 22 44 58
  3. Pharmacodynamic genes do not influence risk of neutropenia in cancer patients treated with moderately high-dose irinotecan. (PMID: 19604089) Hoskins JM … Innocenti F (Pharmacogenomics 2009) 3 22 44 58
  4. The Ala allele at Val762Ala polymorphism in poly(ADP-ribose) polymerase-1 (PARP-1) gene is associated with a decreased risk of asthma in a Turkish population. (PMID: 19484672) Tezcan G … Kanigur-Sultuybek G (The Journal of asthma : official journal of the Association for the Care of Asthma 2009) 3 22 44 58
  5. Irinotecan pharmacogenetics: influence of pharmacodynamic genes. (PMID: 18347181) Hoskins JM … Baiget M (Clinical cancer research : an official journal of the American Association for Cancer Research 2008) 3 22 44 58

Products for PARP1 Gene

  • Addgene plasmids for PARP1

Sources for PARP1 Gene

Content
Loading form....