Aliases for ZRANB1 Gene

Aliases for ZRANB1 Gene

  • Zinc Finger RANBP2-Type Containing 1 2 3 5
  • TRABID 2 3 4
  • Zinc Finger Ran-Binding Domain-Containing Protein 1 3 4
  • Zinc Finger, RAN-Binding Domain Containing 1 2 3
  • TRAF-Binding Domain-Containing Protein 3 4
  • Ubiquitin Thioesterase ZRANB1 3 4
  • HTrabid 3 4
  • TRAF-Binding Protein Domain 3
  • EC 3.4.19.12 4
  • EC 3.1.2 50
  • ZRANB1 5

External Ids for ZRANB1 Gene

Previous GeneCards Identifiers for ZRANB1 Gene

  • GC10P126671
  • GC10P126205
  • GC10P126620
  • GC10P120317
  • GC10P124918

Summaries for ZRANB1 Gene

GeneCards Summary for ZRANB1 Gene

ZRANB1 (Zinc Finger RANBP2-Type Containing 1) is a Protein Coding gene. Among its related pathways are Protein ubiquitination and Deubiquitination. Gene Ontology (GO) annotations related to this gene include thiol-dependent ubiquitin-specific protease activity and K63-linked polyubiquitin modification-dependent protein binding.

UniProtKB/Swiss-Prot Summary for ZRANB1 Gene

  • Specifically hydrolyzes 'Lys-29'-linked and 'Lys-33'-linked diubiquitin. Also cleaves 'Lys-63'-linked chains, but with 40-fold less efficiency compared to 'Lys-29'-linked ones. Positive regulator of the Wnt signaling pathway that deubiquitinates APC protein, a negative regulator of Wnt-mediated transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling.

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ZRANB1 Gene

Genomics for ZRANB1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for ZRANB1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ZRANB1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ZRANB1

Top Transcription factor binding sites by QIAGEN in the ZRANB1 gene promoter:
  • AP-4
  • AREB6
  • CUTL1
  • E4BP4
  • Evi-1
  • Lmo2
  • MRF-2
  • S8

Genomic Locations for ZRANB1 Gene

Latest Assembly
chr10:124,939,489-124,988,189
(GRCh38/hg38)
Size:
48,701 bases
Orientation:
Plus strand

Previous Assembly
chr10:126,630,692-126,676,758
(GRCh37/hg19 by Entrez Gene)
Size:
46,067 bases
Orientation:
Plus strand

chr10:126,630,692-126,676,758
(GRCh37/hg19 by Ensembl)
Size:
46,067 bases
Orientation:
Plus strand

Genomic View for ZRANB1 Gene

Genes around ZRANB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZRANB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZRANB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZRANB1 Gene

Proteins for ZRANB1 Gene

  • Protein details for ZRANB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UGI0-ZRAN1_HUMAN
    Recommended name:
    Ubiquitin thioesterase ZRANB1
    Protein Accession:
    Q9UGI0
    Secondary Accessions:
    • B4DZ98
    • D3DRF4
    • Q5SQP6
    • Q69YK3

    Protein attributes for ZRANB1 Gene

    Size:
    708 amino acids
    Molecular mass:
    80967 Da
    Quaternary structure:
    • Interacts with APC and TRAF6.
    SequenceCaution:
    • Sequence=BAG64010.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for ZRANB1 Gene

neXtProt entry for ZRANB1 Gene

Selected DME Specific Peptides for ZRANB1 Gene

Q9UGI0:
  • ENWPSAIKCTMCRA
  • LICPDSSARPRV
  • GIKWACEYCT
  • DFKKLKQI
  • DCSHWFY
  • DWLFLNAC
  • VCPELTEQIRRE
  • LAHILRRPIIVYGVKY
  • SGGDIARQL
  • TDLVTFTLPADIEDLPP
  • KSPIALGYTRGHFSALV
  • DPCEEYNDRN
  • CTYLNWPR
  • TFLPLVDSERKLLH
  • DCCVTEGGVLVAMQKSSRRRNHPLVTQMVEKWLD

Post-translational modifications for ZRANB1 Gene

  • Ubiquitination at Lys77
  • Modification sites at PhosphoSitePlus

Other Protein References for ZRANB1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for ZRANB1 Gene

Gene Families for ZRANB1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for ZRANB1 Gene

InterPro:
Blocks:
  • Zn-finger, Ran-binding
  • OTU-like cysteine protease

Suggested Antigen Peptide Sequences for ZRANB1 Gene

GenScript: Design optimal peptide antigens:
  • hTrabid (ZRAN1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9UGI0

UniProtKB/Swiss-Prot:

ZRAN1_HUMAN :
  • The OTU domain mediates the deubiquitinating activity.
  • Belongs to the peptidase C64 family.
Domain:
  • The OTU domain mediates the deubiquitinating activity.
  • The RanBP2-type zinc fingers mediate the specific interaction with 'Lys-63'-linked ubiquitin.
  • The second ankyrin repeat ANK 2 is termed AnkUBD, it interacts with ubiquitin hydrophobic patch and contributes to linkage specificity.
  • The RanBP2-type zinc fingers, also called NZFs, may provide additional ubiquitin-binding sites when hydrolyzing long 'Lys-63'-linked chains.
Family:
  • Belongs to the peptidase C64 family.
genes like me logo Genes that share domains with ZRANB1: view

Function for ZRANB1 Gene

Molecular function for ZRANB1 Gene

UniProtKB/Swiss-Prot Function:
Specifically hydrolyzes 'Lys-29'-linked and 'Lys-33'-linked diubiquitin. Also cleaves 'Lys-63'-linked chains, but with 40-fold less efficiency compared to 'Lys-29'-linked ones. Positive regulator of the Wnt signaling pathway that deubiquitinates APC protein, a negative regulator of Wnt-mediated transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000269|PubMed:23827681};.

Enzyme Numbers (IUBMB) for ZRANB1 Gene

Phenotypes From GWAS Catalog for ZRANB1 Gene

Gene Ontology (GO) - Molecular Function for ZRANB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004843 thiol-dependent ubiquitin-specific protease activity IBA,IMP 18281465
GO:0005515 protein binding IPI 11463333
GO:0008233 peptidase activity IEA --
GO:0008234 cysteine-type peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with ZRANB1: view
genes like me logo Genes that share phenotypes with ZRANB1: view

Animal Models for ZRANB1 Gene

MGI Knock Outs for ZRANB1:
  • Zranb1 Zranb1<tm1d(EUCOMM)Hmgu>
  • Zranb1 Zranb1<tm1a(EUCOMM)Hmgu>
  • Zranb1 Zranb1<tm1b(EUCOMM)Hmgu>

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZRANB1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ZRANB1 Gene

Localization for ZRANB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZRANB1 Gene

Cytoplasm. Nucleus. Note=Enriched in punctate localization in the cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZRANB1 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for ZRANB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA 11463333
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IBA,IDA 11463333
GO:0005829 cytosol TAS --
GO:0043231 intracellular membrane-bounded organelle IDA --
genes like me logo Genes that share ontologies with ZRANB1: view

Pathways & Interactions for ZRANB1 Gene

genes like me logo Genes that share pathways with ZRANB1: view

Pathways by source for ZRANB1 Gene

Gene Ontology (GO) - Biological Process for ZRANB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0007010 cytoskeleton organization IMP 21834987
GO:0016055 Wnt signaling pathway IEA --
GO:0016477 cell migration IMP 21834987
GO:0016579 protein deubiquitination TAS --
genes like me logo Genes that share ontologies with ZRANB1: view

No data available for SIGNOR curated interactions for ZRANB1 Gene

Drugs & Compounds for ZRANB1 Gene

No Compound Related Data Available

Transcripts for ZRANB1 Gene

mRNA/cDNA for ZRANB1 Gene

1 REFSEQ mRNAs :
5 NCBI additional mRNA sequence :
2 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZRANB1

Alternative Splicing Database (ASD) splice patterns (SP) for ZRANB1 Gene

No ASD Table

Relevant External Links for ZRANB1 Gene

GeneLoc Exon Structure for
ZRANB1

Expression for ZRANB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for ZRANB1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ZRANB1 Gene

This gene is overexpressed in Muscle - Skeletal (x4.6).

Protein differential expression in normal tissues from HIPED for ZRANB1 Gene

This gene is overexpressed in Serum (41.2) and Plasma (24.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ZRANB1 Gene



Protein tissue co-expression partners for ZRANB1 Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ZRANB1

SOURCE GeneReport for Unigene cluster for ZRANB1 Gene:

Hs.595158

mRNA Expression by UniProt/SwissProt for ZRANB1 Gene:

Q9UGI0-ZRAN1_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for ZRANB1 Gene

  • Heart(4.3)
  • Nervous system(3.1)
  • Muscle(2)
  • Kidney(2)
genes like me logo Genes that share expression patterns with ZRANB1: view

Primer products for research

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for ZRANB1 Gene

Orthologs for ZRANB1 Gene

This gene was present in the common ancestor of animals.

Orthologs for ZRANB1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia ZRANB1 29 30
  • 99.76 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia ZRANB1 29 30
  • 94.28 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia LOC100360606 29
  • 93.74 (n)
Mouse
(Mus musculus)
Mammalia Zranb1 29 16 30
  • 93.31 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia ZRANB1 29 30
  • 93.31 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia ZRANB1 30
  • 92 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia ZRANB1 30
  • 88 (a)
OneToOne
Chicken
(Gallus gallus)
Aves ZRANB1 29 30
  • 85.75 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia ZRANB1 30
  • 96 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia zranb1 29
  • 77.78 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.9866 29
Zebrafish
(Danio rerio)
Actinopterygii CABZ01057907.1 30
  • 80 (a)
OneToMany
zranb1b 29 30
  • 69.59 (n)
OneToMany
Dr.14548 29
Fruit Fly
(Drosophila melanogaster)
Insecta trbd 29 30
  • 50.26 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP003853 29
  • 49.84 (n)
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 30
  • 48 (a)
OneToOne
Species where no ortholog for ZRANB1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)
  • Worm (Caenorhabditis elegans)

Evolution for ZRANB1 Gene

ENSEMBL:
Gene Tree for ZRANB1 (if available)
TreeFam:
Gene Tree for ZRANB1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ZRANB1: view image
Alliance of Genome Resources:
Additional Orthologs for ZRANB1

Paralogs for ZRANB1 Gene

No data available for Paralogs for ZRANB1 Gene

Variants for ZRANB1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ZRANB1 Gene

SNP ID Clinical significance and condition Chr 10 pos Variation AA Info Type
rs75293113 Benign: not provided 124,983,198(+) G/T
NM_017580.3(ZRANB1):c.1572G>T (p.Thr524=)
SYNONYMOUS

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for ZRANB1 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for ZRANB1 Gene

Variant ID Type Subtype PubMed ID
nsv552289 CNV loss 21841781

Variation tolerance for ZRANB1 Gene

Residual Variation Intolerance Score: 6.91% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.72; 57.55% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ZRANB1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZRANB1
Leiden Open Variation Database (LOVD)
ZRANB1

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZRANB1 Gene

Disorders for ZRANB1 Gene

Additional Disease Information for ZRANB1

No disorders were found for ZRANB1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZRANB1 Gene

Publications for ZRANB1 Gene

  1. Isolation and characterization of two novel A20-like proteins. (PMID: 11463333) Evans PC … Kilshaw PJ (The Biochemical journal 2001) 2 3 4 22
  2. OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis. (PMID: 23827681) Mevissen TE … Komander D (Cell 2013) 3 4
  3. Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration. (PMID: 21834987) Bai SW … Ridley AJ (BMC biology 2011) 3 4
  4. An ankyrin-repeat ubiquitin-binding domain determines TRABID's specificity for atypical ubiquitin chains. (PMID: 22157957) Licchesi JD … Komander D (Nature structural & molecular biology 2011) 3 4
  5. Trabid, a new positive regulator of Wnt-induced transcription with preference for binding and cleaving K63-linked ubiquitin chains. (PMID: 18281465) Tran H … Bienz M (Genes & development 2008) 3 4

Products for ZRANB1 Gene

Sources for ZRANB1 Gene