Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ZDHHC9 Gene

Aliases for ZDHHC9 Gene

  • Zinc Finger DHHC-Type Containing 9 2 3 5
  • Zinc Finger Protein 379 3 4
  • Zinc Finger Protein 380 3 4
  • CXorf11 3 4
  • ZDHHC10 3 4
  • ZNF379 3 4
  • ZNF380 3 4
  • DHHC9 3 4
  • Zinc Finger DHHC Domain-Containing Protein 9 4
  • Asp-His-His-Cys Domain Containing Protein 9 3
  • Zinc Finger, DHHC Domain Containing 10 3
  • Zinc Finger, DHHC-Type Containing 10 2
  • Chromosome X Open Reading Frame 11 2
  • Palmitoyltransferase ZDHHC9 3
  • Antigen MMSA-1 3
  • EC 2.3.1.225 4
  • EC 2.3.1.12 56
  • EC 2.3.1 56
  • DHHC-9 4
  • CGI89 3
  • MMSA1 3
  • MRXSZ 3

External Ids for ZDHHC9 Gene

Previous HGNC Symbols for ZDHHC9 Gene

  • ZDHHC10
  • CXorf11

Previous GeneCards Identifiers for ZDHHC9 Gene

  • GC0XM123585
  • GC0XM125785
  • GC0XM126883
  • GC0XM127645
  • GC0XM128664
  • GC0XM128766
  • GC0XM128938
  • GC0XM118338

Summaries for ZDHHC9 Gene

Entrez Gene Summary for ZDHHC9 Gene

  • This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, May 2010]

GeneCards Summary for ZDHHC9 Gene

ZDHHC9 (Zinc Finger DHHC-Type Containing 9) is a Protein Coding gene. Diseases associated with ZDHHC9 include Mental Retardation, X-Linked, Syndromic, Raymond Type and Syndromic X-Linked Intellectual Disability Raymond Type. Gene Ontology (GO) annotations related to this gene include protein-cysteine S-palmitoyltransferase activity and Ras palmitoyltransferase activity. An important paralog of this gene is ZDHHC14.

UniProtKB/Swiss-Prot for ZDHHC9 Gene

  • The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

Gene Wiki entry for ZDHHC9 Gene

Additional gene information for ZDHHC9 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ZDHHC9 Gene

Genomics for ZDHHC9 Gene

GeneHancer (GH) Regulatory Elements for ZDHHC9 Gene

Promoters and enhancers for ZDHHC9 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH0XI129842 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE dbSUPER 556.7 +0.5 495 2.3 PKNOX1 ATF1 ARID4B SIN3A DMAP1 GLIS2 FOS ATF7 SP3 SP5 ZDHHC9 ZNF280C BCORL1 ENSG00000275070
GH0XI129677 Enhancer 1 Ensembl ENCODE 12 +165.7 165691 1.9 FOXA2 RB1 ZSCAN4 SIN3A THRB EGR2 HCFC1 RXRA ELF1 SP1 LOC105373334 GC0XM129676 APLN ZDHHC9 GC0XP129460
GH0XI129808 Enhancer 0.9 FANTOM5 Ensembl dbSUPER 13.3 +35.5 35530 0.6 FOSL1 CEBPB CEBPG HNF4A XPNPEP2 ZDHHC9 ELF4 ENSG00000275070
GH0XI129770 Promoter/Enhancer 2.7 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 4.4 +64.2 64176 17.9 HDGF PKNOX1 FOXA2 SMAD1 ZFP64 IRF4 YY1 TCF12 ZNF766 GATA2 SASH3 ZNF280C BCORL1 XPNPEP2 UTP14A SLC25A14 OCRL ELF4 ENSG00000240143 ZDHHC9
GH0XI129823 Enhancer 0.8 ENCODE dbSUPER 14.2 +20.6 20614 0.2 SMARCA5 CTCF ZNF654 TRIM22 REST RAD21 ZFP69B ZNF664 ZNF692 ZNF143 ZDHHC9 UTP14A APLN XPNPEP2 ENSG00000275070
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around ZDHHC9 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the ZDHHC9 gene promoter:

Genomic Locations for ZDHHC9 Gene

Genomic Locations for ZDHHC9 Gene
chrX:129,803,288-129,843,934
(GRCh38/hg38)
Size:
40,647 bases
Orientation:
Minus strand
chrX:128,937,264-128,977,910
(GRCh37/hg19)

Genomic View for ZDHHC9 Gene

Genes around ZDHHC9 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC9 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC9 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC9 Gene

Proteins for ZDHHC9 Gene

  • Protein details for ZDHHC9 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9Y397-ZDHC9_HUMAN
    Recommended name:
    Palmitoyltransferase ZDHHC9
    Protein Accession:
    Q9Y397
    Secondary Accessions:
    • B4F6G2
    • D3DTF9
    • Q59EK4
    • Q5JSW5
    • Q8WWS7
    • Q9BPY4
    • Q9NSP0
    • Q9NVL0
    • Q9NVR6

    Protein attributes for ZDHHC9 Gene

    Size:
    364 amino acids
    Molecular mass:
    40916 Da
    Quaternary structure:
    • Interacts with GOLGA7.
    SequenceCaution:
    • Sequence=AAD34084.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA91683.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAD93044.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAB82308.1; Type=Erroneous initiation; Evidence={ECO:0000305};

neXtProt entry for ZDHHC9 Gene

Selected DME Specific Peptides for ZDHHC9 Gene

Q9Y397:
  • TTNEDIKGSW
  • IEMEIEA
  • NCVERFDHHCPW
  • TLLRTSFSDPGV
  • SFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRI
  • SPAIPVFAAMLFLFSMATLLR
  • RFDHHCPWVG
  • RPPRASHCS
  • VLCGPLPPS

Post-translational modifications for ZDHHC9 Gene

Other Protein References for ZDHHC9 Gene

Domains & Families for ZDHHC9 Gene

Gene Families for ZDHHC9 Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted membrane proteins

Protein Domains for ZDHHC9 Gene

Suggested Antigen Peptide Sequences for ZDHHC9 Gene

Graphical View of Domain Structure for InterPro Entry

Q9Y397

UniProtKB/Swiss-Prot:

ZDHC9_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
Family:
  • Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
genes like me logo Genes that share domains with ZDHHC9: view

Function for ZDHHC9 Gene

Molecular function for ZDHHC9 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
UniProtKB/Swiss-Prot Function:
The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

Enzyme Numbers (IUBMB) for ZDHHC9 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 25910212
GO:0016409 palmitoyltransferase activity IDA,IEA 23034182
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0019706 protein-cysteine S-palmitoyltransferase activity IEA --
genes like me logo Genes that share ontologies with ZDHHC9: view
genes like me logo Genes that share phenotypes with ZDHHC9: view

Human Phenotype Ontology for ZDHHC9 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Phenotypes From GWAS Catalog , Animal Models , Transcription Factor Targets and HOMER Transcription for ZDHHC9 Gene

Localization for ZDHHC9 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC9 Gene

Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC9 gene
Compartment Confidence
endoplasmic reticulum 5
cytosol 5
golgi apparatus 5
plasma membrane 3
mitochondrion 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Golgi apparatus (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for ZDHHC9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002178 palmitoyltransferase complex IDA 16000296
GO:0005783 endoplasmic reticulum IEA,IDA 16000296
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0005794 Golgi apparatus IEA,IDA 16647879
GO:0005829 cytosol IDA --
genes like me logo Genes that share ontologies with ZDHHC9: view

Pathways & Interactions for ZDHHC9 Gene

SuperPathways for ZDHHC9 Gene

No Data Available

Gene Ontology (GO) - Biological Process for ZDHHC9 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0018230 peptidyl-L-cysteine S-palmitoylation IDA 16000296
GO:0018345 protein palmitoylation IDA 23034182
genes like me logo Genes that share ontologies with ZDHHC9: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC9 Gene

Drugs & Compounds for ZDHHC9 Gene

(1) Drugs for ZDHHC9 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Investigational Nutra 0

(1) Additional Compounds for ZDHHC9 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
genes like me logo Genes that share compounds with ZDHHC9: view

Transcripts for ZDHHC9 Gene

Unigene Clusters for ZDHHC9 Gene

Zinc finger, DHHC-type containing 9:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC9 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5a · 5b · 5c · 5d · 5e ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9 ^ 10 ^ 11 ^ 12 ^ 13
SP1: - - - - -
SP2: - - - - - - - -
SP3: - - -
SP4:
SP5: - - - - -
SP6: - - - -
SP7: - - - -
SP8:
SP9:

Relevant External Links for ZDHHC9 Gene

GeneLoc Exon Structure for
ZDHHC9
ECgene alternative splicing isoforms for
ZDHHC9

Expression for ZDHHC9 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ZDHHC9 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for ZDHHC9 Gene

This gene is overexpressed in Frontal cortex (69.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ZDHHC9 Gene



Protein tissue co-expression partners for ZDHHC9 Gene

NURSA nuclear receptor signaling pathways regulating expression of ZDHHC9 Gene:

ZDHHC9

SOURCE GeneReport for Unigene cluster for ZDHHC9 Gene:

Hs.193566

mRNA Expression by UniProt/SwissProt for ZDHHC9 Gene:

Q9Y397-ZDHC9_HUMAN
Tissue specificity: Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.

Evidence on tissue expression from TISSUES for ZDHHC9 Gene

  • Nervous system(5)
  • Kidney(4.7)
  • Muscle(4.2)
  • Intestine(2.2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC9 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • endocrine
  • integumentary
  • nervous
  • reproductive
  • respiratory
  • skeletal muscle
  • skeleton
  • urinary
Regions:
Head and neck:
  • brain
  • cheek
  • chin
  • cranial nerve
  • ear
  • eye
  • face
  • forehead
  • head
  • jaw
  • larynx
  • lip
  • mandible
  • maxilla
  • mouth
  • neck
  • nose
  • outer ear
  • pharynx
  • skull
  • tooth
  • vocal cord
Thorax:
  • aorta
  • chest wall
  • heart
  • heart valve
  • lung
  • rib
  • rib cage
  • sternum
Pelvis:
  • pelvis
  • testicle
Limb:
  • ankle
  • digit
  • elbow
  • finger
  • foot
  • hand
  • hip
  • knee
  • lower limb
  • shoulder
  • toe
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • peripheral nervous system
  • skin
  • spinal column
  • vertebrae
genes like me logo Genes that share expression patterns with ZDHHC9: view

Primer Products

No data available for mRNA differential expression in normal tissues for ZDHHC9 Gene

Orthologs for ZDHHC9 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ZDHHC9 Gene

Organism Taxonomy Gene Similarity Type Details
dog
(Canis familiaris)
Mammalia ZDHHC9 33 34
  • 94.78 (n)
cow
(Bos Taurus)
Mammalia ZDHHC9 33 34
  • 94.49 (n)
mouse
(Mus musculus)
Mammalia Zdhhc9 33 16 34
  • 93.41 (n)
rat
(Rattus norvegicus)
Mammalia Zdhhc9 33
  • 92.67 (n)
oppossum
(Monodelphis domestica)
Mammalia ZDHHC9 34
  • 91 (a)
OneToOne
chimpanzee
(Pan troglodytes)
Mammalia ZDHHC9 33
  • 90.15 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia ZDHHC9 34
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves ZDHHC9 33 34
  • 79.04 (n)
lizard
(Anolis carolinensis)
Reptilia ZDHHC9 34
  • 80 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia zdhhc9 33
  • 74.41 (n)
Str.12060 33
zebrafish
(Danio rerio)
Actinopterygii zdhhc9 33 34
  • 71.52 (n)
fruit fly
(Drosophila melanogaster)
Insecta app 34
  • 25 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea Y47H9C.2 35
  • 46 (a)
dhhc-2 34
  • 34 (a)
OneToMany
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0D18370g 33
  • 45.74 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AGL125C 33
  • 45.55 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes ERF2 33 36
  • 43.18 (n)
rice
(Oryza sativa)
Liliopsida Os11g0534300 33
  • 52.33 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.3762 34
  • 50 (a)
OneToMany
bread mold
(Neurospora crassa)
Ascomycetes NCU02015 33
  • 41 (n)
Species where no ortholog for ZDHHC9 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ZDHHC9 Gene

ENSEMBL:
Gene Tree for ZDHHC9 (if available)
TreeFam:
Gene Tree for ZDHHC9 (if available)

Paralogs for ZDHHC9 Gene

(4) SIMAP similar genes for ZDHHC9 Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with ZDHHC9: view

Variants for ZDHHC9 Gene

Sequence variations from dbSNP and Humsavar for ZDHHC9 Gene

SNP ID Clin Chr 0X pos Variation AA Info Type
rs137852214 pathogenic, Mental retardation, X-linked, syndromic, Raymond type, Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM:300799] 129,823,724(-) G/A coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs137852215 pathogenic, Mental retardation, X-linked, syndromic, Raymond type, Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM:300799] 129,823,718(-) G/A coding_sequence_variant, missense_variant, non_coding_transcript_variant
rs139619000 benign, Mental retardation, X-linked, syndromic, Raymond type 129,810,908(-) G/A coding_sequence_variant, genic_downstream_transcript_variant, non_coding_transcript_variant, synonymous_variant
rs606231182 pathogenic, Mental retardation, X-linked, syndromic, Raymond type 129,829,134(-) AGCG/ coding_sequence_variant, frameshift, non_coding_transcript_variant
rs606231183 pathogenic, Mental retardation, X-linked, syndromic, Raymond type 129,841,774(-) C/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC9 Gene

Variant ID Type Subtype PubMed ID
nsv7087 CNV deletion 18451855
nsv528290 CNV gain 19592680
nsv526197 CNV gain 19592680
nsv1149298 CNV insertion 26484159
esv3577248 CNV gain 25503493
esv2758893 CNV gain+loss 17122850

Variation tolerance for ZDHHC9 Gene

Residual Variation Intolerance Score: 14.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.11; 2.55% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ZDHHC9 Gene

Human Gene Mutation Database (HGMD)
ZDHHC9
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC9

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC9 Gene

Disorders for ZDHHC9 Gene

MalaCards: The human disease database

(5) MalaCards diseases for ZDHHC9 Gene - From: HGMD, OMIM, ClinVar, GTR, Swiss-Prot, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
mental retardation, x-linked, syndromic, raymond type
  • mrxsr
syndromic x-linked intellectual disability raymond type
  • mental retardation, x-linked, syndromic, raymond type
lujan-fryns syndrome
  • mental retardation, x-linked, with marfanoid habitus
fryns syndrome
  • frns
benign epilepsy with centrotemporal spikes
  • centrotemporal epilepsy
- elite association - COSMIC cancer census association via MalaCards

UniProtKB/Swiss-Prot

ZDHC9_HUMAN
  • Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM:300799]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. Some MRXSZ patients have marfanoid habitus as an additional feature. {ECO:0000269 PubMed:17436253, ECO:0000269 PubMed:19377476}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for ZDHHC9

genes like me logo Genes that share disorders with ZDHHC9: view

No data available for Genatlas for ZDHHC9 Gene

Publications for ZDHHC9 Gene

  1. DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras. (PMID: 16000296) Swarthout JT … Linder ME (The Journal of biological chemistry 2005) 3 4 22 58
  2. Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. (PMID: 10810093) Lai CH … Lin W (Genome research 2000) 2 3 4 58
  3. Mutations in ZDHHC9, which encodes a palmitoyltransferase of NRAS and HRAS, cause X-linked mental retardation associated with a Marfanoid habitus. (PMID: 17436253) Raymond FL … Futreal PA (American journal of human genetics 2007) 3 4 58
  4. Differential expression of DHHC9 in microsatellite stable and instable human colorectal cancer subgroups. (PMID: 17519897) Mansilla F … Orntoft TF (British journal of cancer 2007) 3 22 58
  5. Serological identification and bioinformatics analysis of immunogenic antigens in multiple myeloma. (PMID: 16193335) Zhou FL … Liu SH (Cancer immunology, immunotherapy : CII 2006) 3 4 58

Products for ZDHHC9 Gene

Sources for ZDHHC9 Gene

Content
Loading form....