Aliases for ZDHHC6 Gene

Aliases for ZDHHC6 Gene

  • Zinc Finger DHHC-Type Palmitoyltransferase 6 2 3 5
  • ZNF376 2 3 4
  • Zinc Finger DHHC Domain-Containing Protein 6 3 4
  • Zinc Finger DHHC-Type Containing 6 2 3
  • Palmitoyltransferase ZDHHC6 3 4
  • Transmembrane Protein H4 3 4
  • Zinc Finger Protein 376 3 4
  • DHHC-6 3 4
  • EC 2.3.1.225 4
  • FLJ21952 2
  • EC 2.3.1 51
  • ZDHHC6 5
  • DHHC6 3

External Ids for ZDHHC6 Gene

Previous GeneCards Identifiers for ZDHHC6 Gene

  • GC10M113083
  • GC10M113423
  • GC10M114321
  • GC10M113854
  • GC10M114180
  • GC10M107817

Summaries for ZDHHC6 Gene

GeneCards Summary for ZDHHC6 Gene

ZDHHC6 (Zinc Finger DHHC-Type Palmitoyltransferase 6) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include protein-cysteine S-palmitoyltransferase activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC3.

UniProtKB/Swiss-Prot Summary for ZDHHC6 Gene

  • Endoplasmic reticulum palmitoyl acyltransferase that mediates palmitoylation of proteins such as AMFR, CALX, ITPR1 and TFRC (PubMed:22314232, PubMed:22728137, PubMed:25368151, PubMed:28826475). Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins (PubMed:22314232). Mediates palmitoylation of AMFR, promoting AMFR distribution to the peripheral endoplasmic reticulum (PubMed:22728137). Together with SELENOK, palmitoylates ITPR1 in immune cells, leading to regulate ITPR1 stability and function (PubMed:25368151).

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ZDHHC6 Gene

Genomics for ZDHHC6 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for ZDHHC6 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH10J112445 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 614.7 +0.3 302 3.4 HNRNPL CREB1 PRDM10 REST ZNF629 ZNF692 POLR2A TARDBP LARP7 GABPA ZDHHC6 HSALNG0080689 VTI1A ACSL5
GH10J113076 Enhancer 0.8 dbSUPER 21.6 -629.5 -629500 1.5 ZNF629 ZNF501 RBAK ZNF140 KLF7 ZXDB ZNF138 ZNF580 ZNF266 ZNF623 ZDHHC6 VTI1A TCF7L2 ENSG00000225292 lnc-VTI1A-3 SNORA87 HABP2
GH10J112372 Promoter/Enhancer 2 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 8 +70.7 70677 9.3 SP1 GATAD2A REST SOX13 IKZF1 NFKBIZ POLR2A RCOR2 JUND LARP7 ACSL5 VTI1A ZDHHC6 ENSG00000232934
GH10J112381 Enhancer 1.6 FANTOM5 Ensembl ENCODE dbSUPER 7.1 +58.5 58471 14.7 GATAD2A REST TFE3 LEF1 SOX13 IKZF1 RCOR2 JUND FOXA1 RBFOX2 ACSL5 ENSG00000232934 ZDHHC6 VTI1A
GH10J112402 Enhancer 0.8 Ensembl ENCODE dbSUPER 14.6 +42.7 42698 4.7 ATF7 MNT ATF2 JUND ZBTB33 ACSL5 ZDHHC6 ENSG00000232934 VTI1A
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ZDHHC6 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ZDHHC6

Top Transcription factor binding sites by QIAGEN in the ZDHHC6 gene promoter:
  • AML1a
  • FOXJ2
  • FOXJ2 (long isoform)

Genomic Locations for ZDHHC6 Gene

Genomic Locations for ZDHHC6 Gene
chr10:112,424,411-112,447,603
(GRCh38/hg38)
Size:
23,193 bases
Orientation:
Minus strand
chr10:114,190,058-114,206,672
(GRCh37/hg19)
Size:
16,615 bases
Orientation:
Minus strand

Genomic View for ZDHHC6 Gene

Genes around ZDHHC6 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC6 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC6 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC6 Gene

Proteins for ZDHHC6 Gene

  • Protein details for ZDHHC6 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H6R6-ZDHC6_HUMAN
    Recommended name:
    Palmitoyltransferase ZDHHC6
    Protein Accession:
    Q9H6R6
    Secondary Accessions:
    • D3DRB6
    • Q53G45
    • Q96IV7
    • Q9H605

    Protein attributes for ZDHHC6 Gene

    Size:
    413 amino acids
    Molecular mass:
    47663 Da
    Quaternary structure:
    • Homooligomerizes (PubMed:28826475). Interacts with SELENOK (PubMed:25368151).
    SequenceCaution:
    • Sequence=BAB15462.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for ZDHHC6 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ZDHHC6 Gene

Selected DME Specific Peptides for ZDHHC6 Gene

Q9H6R6:
  • QNHASFTLFLLLAPLGC
  • FPYDMGS
  • KIILRNKTSIESWIEEKAKDRIQYYQLDEVF
  • MDHHCPW
  • QYSLTIEQLKQKADKRVRSVRYKVIEDY

Post-translational modifications for ZDHHC6 Gene

  • Palmitoylated at 3 different sites by ZDHHC16 (PubMed:28826475). The combination of the different palmitoylation events strongly affects the quaternary assembly of ZDHHC6, its localization, stability and function (PubMed:28826475). Palmitoylation at Cys-328 accelerates the turnover of ZDHHC6 (PubMed:28826475). Depalmitoylated by LYPLA2 (PubMed:28826475).
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for ZDHHC6 Gene

Gene Families for ZDHHC6 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins

Protein Domains for ZDHHC6 Gene

InterPro:
Blocks:
  • Variant SH3
  • Zn-finger, DHHC type
ProtoNet:

Suggested Antigen Peptide Sequences for ZDHHC6 Gene

GenScript: Design optimal peptide antigens:
  • Zinc finger protein 376 (ZDHC6_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9H6R6

UniProtKB/Swiss-Prot:

ZDHC6_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
  • The C-terminal di-lysine motif confers endoplasmic reticulum localization.
Family:
  • Belongs to the DHHC palmitoyltransferase family.
genes like me logo Genes that share domains with ZDHHC6: view

Function for ZDHHC6 Gene

Molecular function for ZDHHC6 Gene

UniProtKB/Swiss-Prot Function:
Endoplasmic reticulum palmitoyl acyltransferase that mediates palmitoylation of proteins such as AMFR, CALX, ITPR1 and TFRC (PubMed:22314232, PubMed:22728137, PubMed:25368151, PubMed:28826475). Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins (PubMed:22314232). Mediates palmitoylation of AMFR, promoting AMFR distribution to the peripheral endoplasmic reticulum (PubMed:22728137). Together with SELENOK, palmitoylates ITPR1 in immune cells, leading to regulate ITPR1 stability and function (PubMed:25368151).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]; Xref=Rhea:RHEA:36683, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:29950, ChEBI:CHEBI:57287, ChEBI:CHEBI:57379, ChEBI:CHEBI:74151; EC=2.3.1.225; Evidence={ECO:0000269|PubMed:22314232};.

Enzyme Numbers (IUBMB) for ZDHHC6 Gene

Phenotypes From GWAS Catalog for ZDHHC6 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 22728137
GO:0016409 palmitoyltransferase activity IDA 22728137
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0019706 protein-cysteine S-palmitoyltransferase activity IBA 21873635
genes like me logo Genes that share ontologies with ZDHHC6: view
genes like me logo Genes that share phenotypes with ZDHHC6: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC6

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for ZDHHC6 Gene

Localization for ZDHHC6 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC6 Gene

Endoplasmic reticulum membrane. Multi-pass membrane protein. Note=When not palmitoylated, accumulates to dot-like structures in the endoplasmic reticulum (PubMed:28826475). {ECO:0000269 PubMed:28826475}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC6 gene
Compartment Confidence
endoplasmic reticulum 5
golgi apparatus 4
plasma membrane 3
extracellular 1
cytoskeleton 1
mitochondrion 1
nucleus 1
endosome 1
cytosol 1
lysosome 1

Gene Ontology (GO) - Cellular Components for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IBA,IDA 16647879
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0005794 Golgi apparatus IBA 21873635
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with ZDHHC6: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for ZDHHC6 Gene

Pathways & Interactions for ZDHHC6 Gene

PathCards logo

SuperPathways for ZDHHC6 Gene

No Data Available

Gene Ontology (GO) - Biological Process for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006612 protein targeting to membrane IBA 21873635
GO:0010636 positive regulation of mitochondrial fusion IMP 26214738
GO:0018230 peptidyl-L-cysteine S-palmitoylation IBA 21873635
GO:0018345 protein palmitoylation IDA 22728137
GO:0043543 protein acylation IMP 26214738
genes like me logo Genes that share ontologies with ZDHHC6: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC6 Gene

Drugs & Compounds for ZDHHC6 Gene

(1) Drugs for ZDHHC6 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Investigational Nutra 0

(1) Additional Compounds for ZDHHC6 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
  • coenzyme A, S-Hexadecanoate
  • Palmitoyl coenzyme A
  • S-Palmitoylcoenzyme A
  • coenzyme A, S-Hexadecanoic acid
genes like me logo Genes that share compounds with ZDHHC6: view

Transcripts for ZDHHC6 Gene

mRNA/cDNA for ZDHHC6 Gene

8 REFSEQ mRNAs :
18 NCBI additional mRNA sequence :
5 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC6

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC6 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b ^ 3a · 3b · 3c ^ 4a · 4b ^ 5a · 5b ^ 6a · 6b ^ 7 ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12 ^ 13 ^ 14a · 14b · 14c
SP1: - - - - - -
SP2: - - - - - - -
SP3:
SP4: - - -
SP5:
SP6: -
SP7:
SP8: - -

Relevant External Links for ZDHHC6 Gene

GeneLoc Exon Structure for
ZDHHC6

Expression for ZDHHC6 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for ZDHHC6 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

  • Liver (Hepatobiliary System)

Protein differential expression in normal tissues from HIPED for ZDHHC6 Gene

This gene is overexpressed in NK cells (20.0), CD8 Tcells (14.1), Retina (11.2), and Placenta (7.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ZDHHC6 Gene



Protein tissue co-expression partners for ZDHHC6 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ZDHHC6

SOURCE GeneReport for Unigene cluster for ZDHHC6 Gene:

Hs.196990

Evidence on tissue expression from TISSUES for ZDHHC6 Gene

  • Muscle(4.3)
  • Nervous system(4.2)
  • Kidney(2.1)
genes like me logo Genes that share expression patterns with ZDHHC6: view

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC6 Gene

Orthologs for ZDHHC6 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ZDHHC6 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia ZDHHC6 30 31
  • 99.6 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia ZDHHC6 30 31
  • 93.14 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia ZDHHC6 30 31
  • 92.49 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Zdhhc6 30 17 31
  • 89.02 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia ZDHHC6 31
  • 89 (a)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Zdhhc6 30
  • 88.46 (n)
Platypus
(Ornithorhynchus anatinus)
Mammalia ZDHHC6 31
  • 88 (a)
OneToOne
Chicken
(Gallus gallus)
Aves ZDHHC6 30 31
  • 78.71 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia ZDHHC6 31
  • 78 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia zdhhc6 30
  • 70.93 (n)
African clawed frog
(Xenopus laevis)
Amphibia MGC52647 30
Zebrafish
(Danio rerio)
Actinopterygii zdhhc6 30 31
  • 68.61 (n)
OneToOne
wufa04d12 30
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP000886 30
  • 51.48 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta CG5196 30 31
  • 49.17 (n)
OneToMany
CG4483 31
  • 36 (a)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea M18.8 30
  • 50.84 (n)
dhhc-6 31
  • 33 (a)
OneToOne
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PFA3 31
  • 21 (a)
OneToMany
PFA4 33
Thale Cress
(Arabidopsis thaliana)
eudicotyledons AT3G09320 30
  • 48.73 (n)
Rice
(Oryza sativa)
Liliopsida Os05g0458000 30
  • 46.17 (n)
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.1887 30
Species where no ortholog for ZDHHC6 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for ZDHHC6 Gene

ENSEMBL:
Gene Tree for ZDHHC6 (if available)
TreeFam:
Gene Tree for ZDHHC6 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ZDHHC6: view image

Paralogs for ZDHHC6 Gene

Pseudogenes.org Pseudogenes for ZDHHC6 Gene

genes like me logo Genes that share paralogs with ZDHHC6: view

Variants for ZDHHC6 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ZDHHC6 Gene

SNP ID Clinical significance and condition Chr 10 pos Variation AA Info Type
711915 Benign: not provided 112,440,581(-) A/G NON_CODING_TRANSCRIPT_VARIANT,SYNONYMOUS_VARIANT
778473 Benign: not provided 112,438,345(-) A/G NON_CODING_TRANSCRIPT_VARIANT,SYNONYMOUS_VARIANT
779123 Benign: not provided 112,440,609(-) T/C NON_CODING_TRANSCRIPT_VARIANT,SYNONYMOUS_VARIANT
rs34350728 - p.Asp41Asn

Additional dbSNP identifiers (rs#s) for ZDHHC6 Gene

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC6 Gene

Variant ID Type Subtype PubMed ID
esv2741029 CNV deletion 23290073
esv2741040 CNV deletion 23290073
nsv7211 OTHER inversion 18451855
nsv831990 CNV loss 17160897
nsv831991 CNV loss 17160897

Variation tolerance for ZDHHC6 Gene

Residual Variation Intolerance Score: 22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.46; 43.26% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ZDHHC6 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC6

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC6 Gene

Disorders for ZDHHC6 Gene

Additional Disease Information for ZDHHC6

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform

No disorders were found for ZDHHC6 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZDHHC6 Gene

Publications for ZDHHC6 Gene

  1. Identification and dynamics of the human ZDHHC16-ZDHHC6 palmitoylation cascade. (PMID: 28826475) Abrami L … van der Goot FG (eLife 2017) 2 3 4
  2. Toll-like receptor mediated inflammation requires FASN-dependent MYD88 palmitoylation. (PMID: 31427815) Kim YC … Kim HS (Nature chemical biology 2019) 2 3
  3. Molecular Mechanisms by Which Selenoprotein K Regulates Immunity and Cancer. (PMID: 31187393) Marciel MP … Hoffmann PR (Biological trace element research 2019) 2 3
  4. Stable expression and function of the inositol 1,4,5-triphosphate receptor requires palmitoylation by a DHHC6/selenoprotein K complex. (PMID: 25368151) Fredericks GJ … Hoffmann PR (Proceedings of the National Academy of Sciences of the United States of America 2014) 3 4
  5. RING finger palmitoylation of the endoplasmic reticulum Gp78 E3 ubiquitin ligase. (PMID: 22728137) Fairbank M … Nabi IR (FEBS letters 2012) 3 4

Products for ZDHHC6 Gene

Sources for ZDHHC6 Gene