Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ZDHHC6 Gene

Aliases for ZDHHC6 Gene

  • Zinc Finger DHHC-Type Containing 6 2 3 5
  • Zinc Finger DHHC Domain-Containing Protein 6 3 4
  • Transmembrane Protein H4 3 4
  • Zinc Finger Protein 376 3 4
  • DHHC-6 3 4
  • ZNF376 3 4
  • Palmitoyltransferase ZDHHC6 3
  • EC 2.3.1.225 4
  • EC 2.3.1 56

External Ids for ZDHHC6 Gene

Previous GeneCards Identifiers for ZDHHC6 Gene

  • GC10M113083
  • GC10M113423
  • GC10M114321
  • GC10M113854
  • GC10M114180
  • GC10M107817

Summaries for ZDHHC6 Gene

GeneCards Summary for ZDHHC6 Gene

ZDHHC6 (Zinc Finger DHHC-Type Containing 6) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include protein-cysteine S-palmitoyltransferase activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC16.

UniProtKB/Swiss-Prot for ZDHHC6 Gene

  • Endoplasmic reticulum palmitoyl acyltransferase that mediates palmitoylation of proteins such as AMFR, CALX, ITPR1 and TFRC (PubMed:22314232, PubMed:22728137, PubMed:25368151, PubMed:28826475). Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins (PubMed:22314232). Mediates palmitoylation of AMFR, promoting AMFR distribution to the peripheral endoplasmic reticulum (PubMed:22728137). Together with SELENOK, palmitoylates ITPR1 in immune cells, leading to regulate ITPR1 stability and function (PubMed:25368151).

Additional gene information for ZDHHC6 Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ZDHHC6 Gene

Genomics for ZDHHC6 Gene

GeneHancer (GH) Regulatory Elements for ZDHHC6 Gene

Promoters and enhancers for ZDHHC6 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH10I112445 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 583.6 +0.2 191 2.5 HDGF PKNOX1 ARNT ZFP64 ARID4B SIN3A ZNF2 YY1 POLR2B ZNF213 ZDHHC6 VTI1A ACSL5 LOC105378488 TCF7L2 GC10M112255
GH10I113076 Enhancer 0.8 dbSUPER 39.3 -629.9 -629869 1.5 ZNF493 ZFP64 ZNF121 ZNF213 ZNF138 ZNF366 KLF7 ZNF202 ZNF654 SP3 ZDHHC6 ENSG00000225292 VTI1A TCF7L2 RPS15AP30 LOC105378489
GH10I113055 Enhancer 1.7 FANTOM5 Ensembl ENCODE dbSUPER 13.3 -612.6 -612633 9.2 HDGF PKNOX1 ARNT ARID4B FEZF1 ZNF2 ZNF766 ZNF213 FOS REST TCF7L2 ZDHHC6 VTI1A LOC105378488 HABP2 RPS15AP30 LOC105378489
GH10I112372 Promoter/Enhancer 2.4 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 8 +70.3 70308 9.3 FOXA2 ARID4B DMAP1 ETS1 YY1 SLC30A9 ZNF143 ATF7 FOS RXRA ACSL5 ZDHHC6 VTI1A ENSG00000232934 GC10M112255
GH10I112381 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 7 +60.3 60262 10.3 PKNOX1 ATF1 FOXA2 ARNT ZFP64 ARID4B YY1 TCF12 ZNF766 ATF7 ACSL5 ZDHHC6 VTI1A ENSG00000232934 GC10M112255
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around ZDHHC6 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the ZDHHC6 gene promoter:

Genomic Locations for ZDHHC6 Gene

Genomic Locations for ZDHHC6 Gene
chr10:112,424,428-112,447,234
(GRCh38/hg38)
Size:
22,807 bases
Orientation:
Minus strand
chr10:114,190,058-114,206,672
(GRCh37/hg19)

Genomic View for ZDHHC6 Gene

Genes around ZDHHC6 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC6 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC6 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC6 Gene

Proteins for ZDHHC6 Gene

  • Protein details for ZDHHC6 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H6R6-ZDHC6_HUMAN
    Recommended name:
    Palmitoyltransferase ZDHHC6
    Protein Accession:
    Q9H6R6
    Secondary Accessions:
    • D3DRB6
    • Q53G45
    • Q96IV7
    • Q9H605

    Protein attributes for ZDHHC6 Gene

    Size:
    413 amino acids
    Molecular mass:
    47663 Da
    Quaternary structure:
    • Homooligomerizes (PubMed:28826475). Interacts with SELENOK (PubMed:25368151).
    SequenceCaution:
    • Sequence=BAB15462.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for ZDHHC6 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ZDHHC6 Gene

Selected DME Specific Peptides for ZDHHC6 Gene

Q9H6R6:
  • QNHASFTLFLLLAPLGC
  • FPYDMGS
  • KIILRNKTSIESWIEEKAKDRIQYYQLDEVF
  • MDHHCPW
  • QYSLTIEQLKQKADKRVRSVRYKVIEDY

Post-translational modifications for ZDHHC6 Gene

  • Palmitoylated at 3 different sites by ZDHHC16 (PubMed:28826475). The combination of the different palmitoylation events strongly affects the quaternary assembly of ZDHHC6, its localization, stability and function (PubMed:28826475). Palmitoylation at Cys-328 accelerates the turnover of ZDHHC6 (PubMed:28826475). Depalmitoylated by LYPLA2 (PubMed:28826475).

Domains & Families for ZDHHC6 Gene

Gene Families for ZDHHC6 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins

Protein Domains for ZDHHC6 Gene

Suggested Antigen Peptide Sequences for ZDHHC6 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9H6R6

UniProtKB/Swiss-Prot:

ZDHC6_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
  • The C-terminal di-lysine motif confers endoplasmic reticulum localization.
Family:
  • Belongs to the DHHC palmitoyltransferase family.
genes like me logo Genes that share domains with ZDHHC6: view

Function for ZDHHC6 Gene

Molecular function for ZDHHC6 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
UniProtKB/Swiss-Prot Function:
Endoplasmic reticulum palmitoyl acyltransferase that mediates palmitoylation of proteins such as AMFR, CALX, ITPR1 and TFRC (PubMed:22314232, PubMed:22728137, PubMed:25368151, PubMed:28826475). Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins (PubMed:22314232). Mediates palmitoylation of AMFR, promoting AMFR distribution to the peripheral endoplasmic reticulum (PubMed:22728137). Together with SELENOK, palmitoylates ITPR1 in immune cells, leading to regulate ITPR1 stability and function (PubMed:25368151).

Enzyme Numbers (IUBMB) for ZDHHC6 Gene

Phenotypes From GWAS Catalog for ZDHHC6 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 22728137
GO:0016409 palmitoyltransferase activity IDA 22728137
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
GO:0019706 protein-cysteine S-palmitoyltransferase activity IEA --
genes like me logo Genes that share ontologies with ZDHHC6: view
genes like me logo Genes that share phenotypes with ZDHHC6: view

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for ZDHHC6 Gene

Localization for ZDHHC6 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC6 Gene

Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=When not palmitoylated, accumulates to dot-like structures in the endoplasmic reticulum (PubMed:28826475). {ECO:0000269 PubMed:28826475}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC6 gene
Compartment Confidence
endoplasmic reticulum 5
plasma membrane 3
golgi apparatus 1

Gene Ontology (GO) - Cellular Components for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA,IDA 16647879
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with ZDHHC6: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for ZDHHC6 Gene

Pathways & Interactions for ZDHHC6 Gene

SuperPathways for ZDHHC6 Gene

No Data Available

Gene Ontology (GO) - Biological Process for ZDHHC6 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0018345 protein palmitoylation IDA 22728137
genes like me logo Genes that share ontologies with ZDHHC6: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC6 Gene

Drugs & Compounds for ZDHHC6 Gene

(1) Drugs for ZDHHC6 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Investigational Nutra 0

(1) Additional Compounds for ZDHHC6 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
genes like me logo Genes that share compounds with ZDHHC6: view

Transcripts for ZDHHC6 Gene

Unigene Clusters for ZDHHC6 Gene

Zinc finger, DHHC-type containing 6:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC6 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b ^ 3a · 3b · 3c ^ 4a · 4b ^ 5a · 5b ^ 6a · 6b ^ 7 ^ 8 ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12 ^ 13 ^ 14a · 14b · 14c
SP1: - - - - - -
SP2: - - - - - - -
SP3:
SP4: - - -
SP5:
SP6: -
SP7:
SP8: - -

Relevant External Links for ZDHHC6 Gene

GeneLoc Exon Structure for
ZDHHC6
ECgene alternative splicing isoforms for
ZDHHC6

Expression for ZDHHC6 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ZDHHC6 Gene

Protein differential expression in normal tissues from HIPED for ZDHHC6 Gene

This gene is overexpressed in NK cells (20.0), CD8 Tcells (14.1), Retina (11.2), and Placenta (7.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ZDHHC6 Gene



Protein tissue co-expression partners for ZDHHC6 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of ZDHHC6 Gene:

ZDHHC6

SOURCE GeneReport for Unigene cluster for ZDHHC6 Gene:

Hs.196990

Evidence on tissue expression from TISSUES for ZDHHC6 Gene

  • Muscle(4.2)
  • Nervous system(4)
genes like me logo Genes that share expression patterns with ZDHHC6: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC6 Gene

Orthologs for ZDHHC6 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for ZDHHC6 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ZDHHC6 33 34
  • 99.6 (n)
dog
(Canis familiaris)
Mammalia ZDHHC6 33 34
  • 93.14 (n)
cow
(Bos Taurus)
Mammalia ZDHHC6 33 34
  • 92.49 (n)
mouse
(Mus musculus)
Mammalia Zdhhc6 33 16 34
  • 89.02 (n)
oppossum
(Monodelphis domestica)
Mammalia ZDHHC6 34
  • 89 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Zdhhc6 33
  • 88.46 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia ZDHHC6 34
  • 88 (a)
OneToOne
chicken
(Gallus gallus)
Aves ZDHHC6 33 34
  • 78.71 (n)
lizard
(Anolis carolinensis)
Reptilia ZDHHC6 34
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia zdhhc6 33
  • 70.93 (n)
African clawed frog
(Xenopus laevis)
Amphibia MGC52647 33
zebrafish
(Danio rerio)
Actinopterygii zdhhc6 33 34
  • 68.61 (n)
wufa04d12 33
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP000886 33
  • 51.48 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG5196 33 34
  • 49.17 (n)
CG4483 34
  • 36 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea M18.8 33
  • 50.84 (n)
dhhc-6 34
  • 33 (a)
OneToOne
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PFA3 34
  • 21 (a)
OneToMany
PFA4 36
thale cress
(Arabidopsis thaliana)
eudicotyledons AT3G09320 33
  • 48.73 (n)
rice
(Oryza sativa)
Liliopsida Os05g0458000 33
  • 46.17 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.1887 33
Species where no ortholog for ZDHHC6 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for ZDHHC6 Gene

ENSEMBL:
Gene Tree for ZDHHC6 (if available)
TreeFam:
Gene Tree for ZDHHC6 (if available)

Paralogs for ZDHHC6 Gene

Paralogs for ZDHHC6 Gene

Pseudogenes.org Pseudogenes for ZDHHC6 Gene

genes like me logo Genes that share paralogs with ZDHHC6: view

Variants for ZDHHC6 Gene

Sequence variations from dbSNP and Humsavar for ZDHHC6 Gene

SNP ID Clin Chr 10 pos Variation AA Info Type
rs1000017846 -- 112,424,036(-) T/C downstream_transcript_variant
rs1000033978 -- 112,447,241(-) G/A 5_prime_UTR_variant, genic_upstream_transcript_variant, upstream_transcript_variant
rs1000352319 -- 112,444,770(-) A/T genic_upstream_transcript_variant, intron_variant
rs1000355422 -- 112,427,579(-) G/C genic_downstream_transcript_variant, intron_variant
rs1000384943 -- 112,444,395(-) TTTATAGTTTA/TTTA genic_upstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC6 Gene

Variant ID Type Subtype PubMed ID
nsv831991 CNV loss 17160897
nsv831990 CNV loss 17160897
nsv7211 OTHER inversion 18451855
esv2741040 CNV deletion 23290073
esv2741029 CNV deletion 23290073

Variation tolerance for ZDHHC6 Gene

Residual Variation Intolerance Score: 22% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.46; 43.26% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ZDHHC6 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC6

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC6 Gene

Disorders for ZDHHC6 Gene

Additional Disease Information for ZDHHC6

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for ZDHHC6 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZDHHC6 Gene

Publications for ZDHHC6 Gene

  1. Identification and dynamics of the human ZDHHC16-ZDHHC6 palmitoylation cascade. (PMID: 28826475) Abrami L … van der Goot FG (eLife 2017) 3 4 58
  2. Stable expression and function of the inositol 1,4,5-triphosphate receptor requires palmitoylation by a DHHC6/selenoprotein K complex. (PMID: 25368151) Fredericks GJ … Hoffmann PR (Proceedings of the National Academy of Sciences of the United States of America 2014) 3 4 58
  3. RING finger palmitoylation of the endoplasmic reticulum Gp78 E3 ubiquitin ligase. (PMID: 22728137) Fairbank M … Nabi IR (FEBS letters 2012) 3 4 58
  4. Endoplasmic reticulum localization of DHHC palmitoyltransferases mediated by lysine-based sorting signals. (PMID: 21926431) Gorleku OA … Chamberlain LH (The Journal of biological chemistry 2011) 3 4 58
  5. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58

Products for ZDHHC6 Gene

Sources for ZDHHC6 Gene

Content
Loading form....