Aliases for ZDHHC13 Gene

Aliases for ZDHHC13 Gene

  • Zinc Finger DHHC-Type Palmitoyltransferase 13 2 3 5
  • HIP14L 2 3 4
  • Huntingtin-Interacting Protein 14-Related Protein 3 4
  • Zinc Finger DHHC Domain-Containing Protein 13 3 4
  • Putative NF-Kappa-B-Activating Protein 209 3 4
  • Putative MAPK-Activating Protein PM03 3 4
  • Zinc Finger DHHC-Type Containing 13 2 3
  • Palmitoyltransferase ZDHHC13 3 4
  • HIP14-Related Protein 3 4
  • DHHC-13 3 4
  • HIP3RP 3 4
  • Zinc Finger, DHHC Domain Containing 13 3
  • Huntingtin Interacting Protein HIP3RP 3
  • Probable Palmitoyltransferase ZDHHC13 3
  • Huntingtin-Interacting Protein HIP3RP 4
  • EC 2.3.1.225 4
  • FLJ10852 2
  • FLJ10941 2
  • EC 2.3.1 50
  • ZDHHC13 5

External Ids for ZDHHC13 Gene

Previous GeneCards Identifiers for ZDHHC13 Gene

  • GC11P019104
  • GC11P018822

Summaries for ZDHHC13 Gene

GeneCards Summary for ZDHHC13 Gene

ZDHHC13 (Zinc Finger DHHC-Type Palmitoyltransferase 13) is a Protein Coding gene. Diseases associated with ZDHHC13 include Huntington Disease and Osteoporosis. Gene Ontology (GO) annotations related to this gene include obsolete signal transducer activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC17.

UniProtKB/Swiss-Prot Summary for ZDHHC13 Gene

  • Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates (By similarity). Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ZDHHC13 Gene

Genomics for ZDHHC13 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for ZDHHC13 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ZDHHC13 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ZDHHC13

Top Transcription factor binding sites by QIAGEN in the ZDHHC13 gene promoter:
  • aMEF-2
  • HEN1
  • MEF-2
  • MEF-2A
  • NCX
  • NF-kappaB
  • NF-kappaB1
  • NF-kappaB2
  • TBP

Genomic Locations for ZDHHC13 Gene

Latest Assembly
chr11:19,117,099-19,176,422
(GRCh38/hg38)
Size:
59,324 bases
Orientation:
Plus strand

Previous Assembly
chr11:19,138,715-19,197,962
(GRCh37/hg19 by Entrez Gene)
Size:
59,248 bases
Orientation:
Plus strand

chr11:19,138,646-19,197,969
(GRCh37/hg19 by Ensembl)
Size:
59,324 bases
Orientation:
Plus strand

Genomic View for ZDHHC13 Gene

Genes around ZDHHC13 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ZDHHC13 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ZDHHC13 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ZDHHC13 Gene

Proteins for ZDHHC13 Gene

  • Protein details for ZDHHC13 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8IUH4-ZDH13_HUMAN
    Recommended name:
    Palmitoyltransferase ZDHHC13
    Protein Accession:
    Q8IUH4
    Secondary Accessions:
    • Q7Z2D3
    • Q86VK2
    • Q9NV30
    • Q9NV99

    Protein attributes for ZDHHC13 Gene

    Size:
    622 amino acids
    Molecular mass:
    70861 Da
    Quaternary structure:
    • Interacts (via ANK repeats) with CLIP3 (PubMed:26198635). Interacts (via ANK repeats) with DNAJC5 (via C-terminus) (By similarity). Interacts (via ANK repeats) with HTT (PubMed:26198635). Interacts (via ANK repeats) with MAP6 (PubMed:26198635). Interacts (via ANK repeats) with SNAP23. Interacts (via ANK repeats) with SNAP25. May interact (via ANK repeats) with SPRED2 (By similarity).
    SequenceCaution:
    • Sequence=BAA91856.1; Type=Erroneous termination; Note=Truncated C-terminus.; Evidence={ECO:0000305};

    Alternative splice isoforms for ZDHHC13 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for ZDHHC13 Gene

Selected DME Specific Peptides for ZDHHC13 Gene

Q8IUH4:
  • KCELFLLL
  • LHWAAIN
  • KGETPLDMALQ
  • QNLADFFQCGCFGLVKPC
  • HQNTPLHWAVAAGNV
  • AVDKLLEAGSSLDI
  • DGEGFSSIHLAVLFQHMPIIAYLISK
  • AFLYFFYKTWATDPGFTKASEEE
  • LAETGSLD
  • LPLIEDSSNCDIVKATQYGIFERCKELVEAGYDVRQPD
  • HMKQTLSLRKTPYNLGF
  • FHFSWSTFLL
  • WTGRCIGFGNHH
  • WIIYGSF
  • KVIGPEPTGFLLKFNPSL

Post-translational modifications for ZDHHC13 Gene

  • Ubiquitination at Lys80
  • Modification sites at PhosphoSitePlus

Other Protein References for ZDHHC13 Gene

Domains & Families for ZDHHC13 Gene

Gene Families for ZDHHC13 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins
  • Transporters

Protein Domains for ZDHHC13 Gene

InterPro:
Blocks:
  • Ankyrin repeat signature
  • Zn-finger, DHHC type

Suggested Antigen Peptide Sequences for ZDHHC13 Gene

GenScript: Design optimal peptide antigens:
  • Zinc finger, DHHC-type containing 13, isoform CRA_b (C9JYJ4_HUMAN)
  • Zinc finger DHHC domain-containing protein 13 (ZDH13_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q8IUH4

UniProtKB/Swiss-Prot:

ZDH13_HUMAN :
  • The DHHC domain is required for palmitoyltransferase activity.
  • Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
Domain:
  • The DHHC domain is required for palmitoyltransferase activity.
Family:
  • Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
genes like me logo Genes that share domains with ZDHHC13: view

Function for ZDHHC13 Gene

Molecular function for ZDHHC13 Gene

UniProtKB/Swiss-Prot Function:
Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates (By similarity). Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]; Xref=Rhea:RHEA:36683, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:29950, ChEBI:CHEBI:57287, ChEBI:CHEBI:57379, ChEBI:CHEBI:74151; EC=2.3.1.225; Evidence={ECO:0000250|UniProtKB:Q9CWU2};.

Enzyme Numbers (IUBMB) for ZDHHC13 Gene

Phenotypes From GWAS Catalog for ZDHHC13 Gene

Gene Ontology (GO) - Molecular Function for ZDHHC13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IEA --
GO:0015095 magnesium ion transmembrane transporter activity ISS --
GO:0016409 palmitoyltransferase activity ISS --
GO:0016740 transferase activity IEA --
GO:0016746 transferase activity, transferring acyl groups IEA --
genes like me logo Genes that share ontologies with ZDHHC13: view
genes like me logo Genes that share phenotypes with ZDHHC13: view

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for ZDHHC13 Gene

Localization for ZDHHC13 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC13 Gene

Golgi apparatus membrane. Multi-pass membrane protein. Cytoplasmic vesicle membrane. Multi-pass membrane protein. Note=Low extracellular Mg(2+) induces increase in Golgi and in post-Golgi vesicles. {ECO:0000250 UniProtKB:Q9CWU2}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ZDHHC13 gene
Compartment Confidence
endoplasmic reticulum 5
golgi apparatus 4
plasma membrane 3
extracellular 1
cytoskeleton 1
mitochondrion 1
nucleus 1
endosome 1
cytosol 1
lysosome 1
peroxisome 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Vesicles (3)
  • Golgi apparatus (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for ZDHHC13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane IBA,ISS --
GO:0005783 endoplasmic reticulum IDA 16647879
GO:0005794 Golgi apparatus IEA --
GO:0016020 membrane IEA,HDA 19946888
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with ZDHHC13: view

Pathways & Interactions for ZDHHC13 Gene

PathCards logo

SuperPathways for ZDHHC13 Gene

No Data Available

Gene Ontology (GO) - Biological Process for ZDHHC13 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0018215 protein phosphopantetheinylation IEA --
GO:0018345 protein palmitoylation IBA 21873635
GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling HMP 12761501
GO:1903830 magnesium ion transmembrane transport IEA --
genes like me logo Genes that share ontologies with ZDHHC13: view

No data available for Pathways by source and SIGNOR curated interactions for ZDHHC13 Gene

Drugs & Compounds for ZDHHC13 Gene

(1) Drugs for ZDHHC13 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Coenzyme A Investigational Nutra 0

(1) Additional Compounds for ZDHHC13 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
hexadecanoyl-CoA
  • coenzyme A, S-Hexadecanoate
  • Palmitoyl coenzyme A
  • S-Palmitoylcoenzyme A
  • coenzyme A, S-Hexadecanoic acid
  • Hexadecanoyl-CoA
genes like me logo Genes that share compounds with ZDHHC13: view

Transcripts for ZDHHC13 Gene

mRNA/cDNA for ZDHHC13 Gene

2 REFSEQ mRNAs :
13 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13

Alternative Splicing Database (ASD) splice patterns (SP) for ZDHHC13 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14a · 14b ^ 15 ^ 16 ^ 17
SP1: -
SP2: - -
SP3: -
SP4:

Relevant External Links for ZDHHC13 Gene

GeneLoc Exon Structure for
ZDHHC13

Expression for ZDHHC13 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for ZDHHC13 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ZDHHC13 Gene

This gene is overexpressed in Esophagus - Mucosa (x5.1).

Protein differential expression in normal tissues from HIPED for ZDHHC13 Gene

This gene is overexpressed in Nasal epithelium (62.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ZDHHC13 Gene



Protein tissue co-expression partners for ZDHHC13 Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ZDHHC13

SOURCE GeneReport for Unigene cluster for ZDHHC13 Gene:

Hs.188569

Evidence on tissue expression from TISSUES for ZDHHC13 Gene

  • Eye(4.1)
  • Lung(4.1)
  • Nervous system(2.3)
  • Skin(2)
genes like me logo Genes that share expression patterns with ZDHHC13: view

Primer products for research

No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC13 Gene

Orthologs for ZDHHC13 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for ZDHHC13 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia ZDHHC13 29 30
  • 99.62 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia ZDHHC13 29 30
  • 92.02 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia ZDHHC13 29 30
  • 91.16 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Zdhhc13 29 16 30
  • 89.92 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Zdhhc13 29
  • 88.8 (n)
Oppossum
(Monodelphis domestica)
Mammalia ZDHHC13 30
  • 78 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia ZDHHC13 30
  • 77 (a)
OneToOne
Chicken
(Gallus gallus)
Aves ZDHHC13 29 30
  • 68.74 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia ZDHHC13 30
  • 64 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia LOC100493145 29
  • 62.48 (n)
Zebrafish
(Danio rerio)
Actinopterygii zdhhc13 29 30
  • 56.61 (n)
OneToOne
wufi22e09 29
Fruit Fly
(Drosophila melanogaster)
Insecta Hip14 30
  • 35 (a)
OneToMany
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes AKR1 30
  • 20 (a)
ManyToMany
AKR2 30
  • 19 (a)
ManyToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.11093 30
  • 39 (a)
OneToMany
Species where no ortholog for ZDHHC13 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)
  • Worm (Caenorhabditis elegans)

Evolution for ZDHHC13 Gene

ENSEMBL:
Gene Tree for ZDHHC13 (if available)
TreeFam:
Gene Tree for ZDHHC13 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ZDHHC13: view image
Alliance of Genome Resources:
Additional Orthologs for ZDHHC13

Paralogs for ZDHHC13 Gene

Paralogs for ZDHHC13 Gene

(1) SIMAP similar genes for ZDHHC13 Gene using alignment to 1 proteins:

  • ZDH13_HUMAN
genes like me logo Genes that share paralogs with ZDHHC13: view

Variants for ZDHHC13 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ZDHHC13 Gene

SNP ID Clinical significance and condition Chr 11 pos Variation AA Info Type
rs183284767 Likely Benign: not provided 19,163,404(+) G/A
NM_019028.3(ZDHHC13):c.1210G>A (p.Ala404Thr)
MISSENSE
rs12798330 -- p.Tyr392Cys
rs2271001 -- p.Lys99Arg

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for ZDHHC13 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for ZDHHC13 Gene

Variant ID Type Subtype PubMed ID
esv2662583 CNV deletion 23128226
esv3428572 CNV insertion 20981092
esv3625530 CNV loss 21293372
esv3625531 CNV loss 21293372
nsv476084 CNV novel sequence insertion 20440878
nsv477679 CNV novel sequence insertion 20440878

Variation tolerance for ZDHHC13 Gene

Residual Variation Intolerance Score: 27.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.13; 51.30% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ZDHHC13 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
ZDHHC13
Leiden Open Variation Database (LOVD)
ZDHHC13

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC13 Gene

Disorders for ZDHHC13 Gene

MalaCards: The human disease database

(2) MalaCards diseases for ZDHHC13 Gene - From: COP and GCD

Disorder Aliases PubMed IDs
huntington disease
  • hd
osteoporosis
  • bone mineral density quantitative trait locus; bmnd
- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for ZDHHC13

genes like me logo Genes that share disorders with ZDHHC13: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ZDHHC13 Gene

Publications for ZDHHC13 Gene

  1. Huntingtin-interacting proteins, HIP14 and HIP14L, mediate dual functions, palmitoyl acyltransferase and Mg2+ transport. (PMID: 18794299) Goytain A … Quamme GA (The Journal of biological chemistry 2008) 2 3 22
  2. Mice with alopecia, osteoporosis, and systemic amyloidosis due to mutation in Zdhhc13, a gene coding for palmitoyl acyltransferase. (PMID: 20548961) Saleem AN … Chen YT (PLoS genetics 2010) 2 3
  3. Neuronal palmitoyl acyl transferases exhibit distinct substrate specificity. (PMID: 19299482) Huang K … El-Husseini A (FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2009) 2 3
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
  5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4

Products for ZDHHC13 Gene

  • Biorbyt antibodies for ZDHHC13

Sources for ZDHHC13 Gene