Free for academic non-profit institutions. Other users need a Commercial license
Aliases for ZDHHC13 Gene
Aliases for ZDHHC13 Gene
- Zinc Finger DHHC-Type Palmitoyltransferase 13 2 3 5
- HIP14L 2 3 4
- Huntingtin-Interacting Protein 14-Related Protein 3 4
- Zinc Finger DHHC Domain-Containing Protein 13 3 4
- Putative NF-Kappa-B-Activating Protein 209 3 4
- Putative MAPK-Activating Protein PM03 3 4
- Zinc Finger DHHC-Type Containing 13 2 3
- Palmitoyltransferase ZDHHC13 3 4
- HIP14-Related Protein 3 4
- DHHC-13 3 4
External Ids for ZDHHC13 Gene
- HGNC: 18413
- NCBI Entrez Gene: 54503
- Ensembl: ENSG00000177054
- OMIM®: 612815
- UniProtKB/Swiss-Prot: Q8IUH4
Previous GeneCards Identifiers for ZDHHC13 Gene
- GC11P019104
- GC11P018822
Summaries for ZDHHC13 Gene
GeneCards Summary for ZDHHC13 Gene
ZDHHC13 (Zinc Finger DHHC-Type Palmitoyltransferase 13) is a Protein Coding gene. Diseases associated with ZDHHC13 include Huntington Disease and Osteoporosis. Gene Ontology (GO) annotations related to this gene include obsolete signal transducer activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC17.
UniProtKB/Swiss-Prot Summary for ZDHHC13 Gene
-
Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates (By similarity). Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.
Additional gene information for ZDHHC13 Gene
- HGNC (18413)
- NCBI Entrez Gene (54503)
- Ensembl (ENSG00000177054)
- OMIM® (612815)
- UniProtKB/Swiss-Prot (Q8IUH4)
- Open Targets Platform(ENSG00000177054)
- Monarch Initiative
- Alliance of Genome Resources
- Search for ZDHHC13 at DataMed
- Search for ZDHHC13 at HumanCyc
No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ZDHHC13 Gene
Genomics for ZDHHC13 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for ZDHHC13 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around ZDHHC13 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ZDHHC13
- Top Transcription factor binding sites by QIAGEN in the ZDHHC13 gene promoter:
-
- aMEF-2
- HEN1
- MEF-2
- MEF-2A
- NCX
- NF-kappaB
- NF-kappaB1
- NF-kappaB2
- TBP
Genomic Locations for ZDHHC13 Gene
Latest Assembly
- chr11:19,117,099-19,176,422
- (GRCh38/hg38)
- Size:
- 59,324 bases
- Orientation:
- Plus strand
Previous Assembly
- chr11:19,138,715-19,197,962
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 59,248 bases
- Orientation:
- Plus strand
Genomic View for ZDHHC13 Gene
Genes around ZDHHC13 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 11p15.1 by HGNC
- 11p15.1 by Entrez Gene
- 11p15.1 by Ensembl
ZDHHC13 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ZDHHC13 Gene
Proteins for ZDHHC13 Gene
-
Protein details for ZDHHC13 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q8IUH4-ZDH13_HUMAN
- Recommended name:
- Palmitoyltransferase ZDHHC13
- Protein Accession:
- Q8IUH4
- Q7Z2D3
- Q86VK2
- Q9NV30
- Q9NV99
Protein attributes for ZDHHC13 Gene
- Size:
- 622 amino acids
- Molecular mass:
- 70861 Da
- Quaternary structure:
-
- Interacts (via ANK repeats) with CLIP3 (PubMed:26198635). Interacts (via ANK repeats) with DNAJC5 (via C-terminus) (By similarity). Interacts (via ANK repeats) with HTT (PubMed:26198635). Interacts (via ANK repeats) with MAP6 (PubMed:26198635). Interacts (via ANK repeats) with SNAP23. Interacts (via ANK repeats) with SNAP25. May interact (via ANK repeats) with SPRED2 (By similarity).
- SequenceCaution:
-
- Sequence=BAA91856.1; Type=Erroneous termination; Note=Truncated C-terminus.; Evidence={ECO:0000305};
Protein Expression for ZDHHC13 Gene
Selected DME Specific Peptides for ZDHHC13 Gene
- Q8IUH4:
-
- KCELFLLL
- LHWAAIN
- KGETPLDMALQ
- QNLADFFQCGCFGLVKPC
- HQNTPLHWAVAAGNV
- AVDKLLEAGSSLDI
- DGEGFSSIHLAVLFQHMPIIAYLISK
- AFLYFFYKTWATDPGFTKASEEE
- LAETGSLD
- LPLIEDSSNCDIVKATQYGIFERCKELVEAGYDVRQPD
- HMKQTLSLRKTPYNLGF
- FHFSWSTFLL
- WTGRCIGFGNHH
- WIIYGSF
- KVIGPEPTGFLLKFNPSL
Post-translational modifications for ZDHHC13 Gene
Other Protein References for ZDHHC13 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
- LifeSpan BioSciences ZDHHC13 / HIP14L Antibody
- G Biosciences Immunotag™ ZDHHC13 Antibody
-
Custom Antibody ServicesOriGene Antibodies for ZDHHC13
- Novus Biologicals Antibodies for ZDHHC13
-
Abcam antibodies for ZDHHC13
- Invitrogen Antibodies for ZDHHC13 (AFLGC-ZDHHC13)
-
Biorbyt antibodies for ZDHHC13
-
Boster Bio Antibodies for ZDHHC13
Protein products for research
-
OriGene Purified Proteins for ZDHHC13
- Search Origene for MassSpec and Protein Over-expression Lysates for ZDHHC13
- Origene Custom Protein Services for ZDHHC13
- antibodies-online: Show 3 available ZDHHC13 Proteins ranked by validation data
- Compare Top ZDHHC13 Proteins
-
Quality Products:
-
Abcam proteins for ZDHHC13
Assay products for research
Domains & Families for ZDHHC13 Gene
Gene Families for ZDHHC13 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted membrane proteins
- Transporters
Protein Domains for ZDHHC13 Gene
- InterPro:
- Blocks:
-
- Ankyrin repeat signature
- Zn-finger, DHHC type
Suggested Antigen Peptide Sequences for ZDHHC13 Gene
- GenScript: Design optimal peptide antigens:
-
- Zinc finger, DHHC-type containing 13, isoform CRA_b (C9JYJ4_HUMAN)
- Zinc finger DHHC domain-containing protein 13 (ZDH13_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q8IUH4UniProtKB/Swiss-Prot:
ZDH13_HUMAN :- The DHHC domain is required for palmitoyltransferase activity.
- Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
- Domain:
-
- The DHHC domain is required for palmitoyltransferase activity.
- Family:
-
- Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
Function for ZDHHC13 Gene
Molecular function for ZDHHC13 Gene
- UniProtKB/Swiss-Prot Function:
- Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates (By similarity). Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]; Xref=Rhea:RHEA:36683, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:29950, ChEBI:CHEBI:57287, ChEBI:CHEBI:57379, ChEBI:CHEBI:74151; EC=2.3.1.225; Evidence={ECO:0000250|UniProtKB:Q9CWU2};.
Enzyme Numbers (IUBMB) for ZDHHC13 Gene
Phenotypes From GWAS Catalog for ZDHHC13 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005515 | protein binding | IEA | -- |
| GO:0015095 | magnesium ion transmembrane transporter activity | ISS | -- |
| GO:0016409 | palmitoyltransferase activity | ISS | -- |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016746 | transferase activity, transferring acyl groups | IEA | -- |
Phenotypes for ZDHHC13 Gene
- MGI mutant phenotypes for ZDHHC13:
-
inferred from 2 alleles
- nervous system phenotype
- muscle phenotype
- homeostasis/metabolism phenotype
- growth/size/body region phenotype
- cellular phenotype
- cardiovascular system phenotype
- behavior/neurological phenotype
- immune system phenotype
- mortality/aging
- renal/urinary system phenotype
- liver/biliary system phenotype
- hematopoietic system phenotype
- skeleton phenotype
- integument phenotype
- adipose tissue phenotype
- GenomeRNAi human phenotypes for ZDHHC13:
Animal Models for research
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for ZDHHC13 - Starting at $85 >
- * ZDHHC13 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for ZDHHC13
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ZDHHC13
-
Santa Cruz Biotechnology (SCBT) CRISPR for ZDHHC13
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ZDHHC13
- Browse OriGene Inhibitory RNA Products For ZDHHC13
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13
Clone products for research
- Applied Biological Materials (abm): Clones for ZDHHC13 - Starting at $45 >
- * ZDHHC13 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for ZDHHC13
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ZDHHC13
Cell Lines for research
-
Horizon Cell Lines for ZDHHC13
No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for ZDHHC13 Gene
Localization for ZDHHC13 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC13 Gene
- Golgi apparatus membrane. Multi-pass membrane protein. Cytoplasmic vesicle membrane. Multi-pass membrane protein. Note=Low extracellular Mg(2+) induces increase in Golgi and in post-Golgi vesicles. {ECO:0000250 UniProtKB:Q9CWU2}.
| Compartment | Confidence |
|---|---|
| endoplasmic reticulum | 5 |
| golgi apparatus | 4 |
| plasma membrane | 3 |
| extracellular | 1 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
| nucleus | 1 |
| endosome | 1 |
| cytosol | 1 |
| lysosome | 1 |
| peroxisome | 0 |
- Vesicles (3)
- Golgi apparatus (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | IBA,ISS | -- |
| GO:0005783 | endoplasmic reticulum | IDA | 16647879 |
| GO:0005794 | Golgi apparatus | IEA | -- |
| GO:0016020 | membrane | IEA,HDA | 19946888 |
| GO:0016021 | integral component of membrane | IEA | -- |
Pathways & Interactions for ZDHHC13 Gene
Interacting Proteins for ZDHHC13 Gene
GPS-Prot Interaction Network for ZDHHC13
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0018215 | protein phosphopantetheinylation | IEA | -- |
| GO:0018345 | protein palmitoylation | IBA | 21873635 |
| GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling | HMP | 12761501 |
| GO:1903830 | magnesium ion transmembrane transport | IEA | -- |
No data available for Pathways by source and SIGNOR curated interactions for ZDHHC13 Gene
Drugs & Compounds for ZDHHC13 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Coenzyme A | Investigational | Nutra | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| hexadecanoyl-CoA |
|
|
Transcripts for ZDHHC13 Gene
mRNA/cDNA for ZDHHC13 Gene
- 2 REFSEQ mRNAs :
- 13 NCBI additional mRNA sequence :
- 8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000399351 2283 nts (view in UCSC)
- ENST00000446113 2406 nts (view in UCSC)
- ENST00000524744 433 nts (view in UCSC)
- ENST00000525490 6304 nts (view in UCSC)
- ENST00000530100 1279 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for ZDHHC13 - Starting at $85 >
- * ZDHHC13 CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for ZDHHC13
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ZDHHC13
-
Santa Cruz Biotechnology (SCBT) CRISPR for ZDHHC13
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ZDHHC13
- Browse OriGene Inhibitory RNA Products For ZDHHC13
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13
Clone products for research
- Applied Biological Materials (abm): Clones for ZDHHC13 - Starting at $45 >
- * ZDHHC13 as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for ZDHHC13
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ZDHHC13
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14a | · | 14b | ^ | 15 | ^ | 16 | ^ | 17 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||||
| SP2: | - | - | |||||||||||||||||||||||||||||||||||
| SP3: | - | ||||||||||||||||||||||||||||||||||||
| SP4: |
Relevant External Links for ZDHHC13 Gene
- GeneLoc Exon Structure for
- ZDHHC13
Expression for ZDHHC13 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
mRNA differential expression in normal tissues according to GTEx for ZDHHC13 Gene
This gene is overexpressed in Esophagus - Mucosa (x5.1).
This gene is overexpressed in Nasal epithelium (62.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ZDHHC13 Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ZDHHC13
SOURCE GeneReport for Unigene cluster for ZDHHC13 Gene:
Hs.188569Evidence on tissue expression from TISSUES for ZDHHC13 Gene
- Eye(4.1)
- Lung(4.1)
- Nervous system(2.3)
- Skin(2)
Primer products for research
-
OriGene qPCR primer pairs for ZDHHC13
-
OriGene qPCR primer pairs and template standards for ZDHHC13
Gene Expression Assays for research
No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC13 Gene
Orthologs for ZDHHC13 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | ZDHHC13 29 30 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | ZDHHC13 29 30 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | ZDHHC13 29 30 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Zdhhc13 29 16 30 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Zdhhc13 29 |
|
||
| Oppossum (Monodelphis domestica) |
Mammalia | ZDHHC13 30 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | ZDHHC13 30 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | ZDHHC13 29 30 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | ZDHHC13 30 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | LOC100493145 29 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | zdhhc13 29 30 |
|
OneToOne | |
| wufi22e09 29 |
|
||||
| Fruit Fly (Drosophila melanogaster) |
Insecta | Hip14 30 |
|
OneToMany | |
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | AKR1 30 |
|
ManyToMany | |
| AKR2 30 |
|
ManyToMany | |||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.11093 30 |
|
OneToMany |
- Species where no ortholog for ZDHHC13 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
Evolution for ZDHHC13 Gene
- ENSEMBL:
- Gene Tree for ZDHHC13 (if available)
- TreeFam:
- Gene Tree for ZDHHC13 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for ZDHHC13: view image
- Alliance of Genome Resources:
- Additional Orthologs for ZDHHC13
Paralogs for ZDHHC13 Gene
Variants for ZDHHC13 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ZDHHC13 Gene
| SNP ID | Clinical significance and condition | Chr 11 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs183284767 | Likely Benign: not provided | 19,163,404(+) |
G/A NM_019028.3(ZDHHC13):c.1210G>A (p.Ala404Thr) |
MISSENSE | |
| rs12798330 | -- |
p.Tyr392Cys |
|||
| rs2271001 | -- |
p.Lys99Arg |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2662583 | CNV | deletion | 23128226 |
| esv3428572 | CNV | insertion | 20981092 |
| esv3625530 | CNV | loss | 21293372 |
| esv3625531 | CNV | loss | 21293372 |
| nsv476084 | CNV | novel sequence insertion | 20440878 |
| nsv477679 | CNV | novel sequence insertion | 20440878 |
Residual Variation Intolerance Score:
27.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.13;
51.30% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for ZDHHC13 Gene
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC13 Gene
Disorders for ZDHHC13 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| huntington disease |
|
|
| osteoporosis |
|
|
Search ZDHHC13 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for ZDHHC13
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for ZDHHC13 Gene
Publications for ZDHHC13 Gene
- Huntingtin-interacting proteins, HIP14 and HIP14L, mediate dual functions, palmitoyl acyltransferase and Mg2+ transport. (PMID: 18794299) Goytain A … Quamme GA (The Journal of biological chemistry 2008) 2 3 22
- Mice with alopecia, osteoporosis, and systemic amyloidosis due to mutation in Zdhhc13, a gene coding for palmitoyl acyltransferase. (PMID: 20548961) Saleem AN … Chen YT (PLoS genetics 2010) 2 3
- Neuronal palmitoyl acyl transferases exhibit distinct substrate specificity. (PMID: 19299482) Huang K … El-Husseini A (FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2009) 2 3
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
- Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4
ExternalLinks
Products for ZDHHC13 Gene
- Custom Antibody ServicesOriGene Antibodies for ZDHHC13
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ZDHHC13
- Search Origene for MassSpec and Protein Over-expression Lysates for ZDHHC13
- Origene Custom Protein Services for ZDHHC13
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ZDHHC13
- Browse OriGene Inhibitory RNA Products For ZDHHC13
- OriGene qPCR primer pairs for ZDHHC13
- OriGene qPCR primer pairs and template standards for ZDHHC13
- OriGene CRISPR knockouts for ZDHHC13
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ZDHHC13
- Sino Biological Human cDNA Clone for ZDHHC13
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for ZDHHC13
- Novus Biologicals proteins and lysates for ZDHHC13
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for ZDHHC13
- Abcam proteins for ZDHHC13
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for ZDHHC13 (AFLGC-ZDHHC13)
- VectorBuilder Custom and pre-made DNA vectors for ZDHHC13 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for ZDHHC13 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for ZDHHC13 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for ZDHHC13 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for ZDHHC13
- antibodies-online: Show 15 available ZDHHC13 Antibodies ranked by validation data
- Compare Top ZDHHC13 Antibodies
- antibodies-online: Search results for available ZDHHC13 related products ranked by validation data
- antibodies-online: Show 3 available ZDHHC13 Proteins ranked by validation data
- Compare Top ZDHHC13 Proteins
- Quality Products:
- Horizon Cell Lines for ZDHHC13
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ZDHHC13
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ZDHHC13
- Search GeneCopoeia for miRNA 3'UTR Target clone products for ZDHHC13
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13
- Boster Bio Antibodies for ZDHHC13
- Browse Boster Bio ELISA Kits
- Biorbyt antibodies for ZDHHC13
Sources for ZDHHC13 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Apr-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) ASD
- (27) SAGE
- (28) SOURCE
- (29) HomoloGene
- (30) PanEnsembl
- (31) euGenes
- (32) SGD
- (33) FlyBase
- (34) WormBase
- (35) Pseudogene
- (36) DGV
- (37) dbSNP
- (38) GenAtlas
- (39) HGMD
- (40) GAD
- (41) BGMUT
- (42) HuGE
- (43) Atlas
- (44) GenBank
- (45) HORDE
- (46) HUGE
- (47) IMGT
- (48) Leiden
- (49) miRBase
- (50) DME
- (51) OriGene
- (52) PubMed
- (53) R&D Systems
- (54) Tocris
- (55) Abcam
- (56) Novus Biologicals
- (57) ProSpec
- (58) Sino Biological
- (59) GenScript
- (60) Qiagen
- (61) OCA
- (62) Proteopedia
- (63) MOPED
- (64) neXtProt
- (65) Reactome
- (66) GeneGo (Thomson Reuters)
- (67) DISEASES
- (68) SIMAP
- (69) GenomeRNAi
- (70) LifeMap
- (71) miRTarBase
- (72) MalaCards
- (73) Invitrogen
- (74) BitterDB
- (75) ESI-BIO
- (76) RefSeq
- (77) BioSystems
- (78) MaxQB
- (79) IUPHAR
- (80) BioGPS
- (81) Illumina
- (82) COMPARTMENTS
- (83) HOMER
- (84) PaxDb
- (85) ApexBio
- (86) Addgene
- (87) antibodies-online
- (88) CYP
- (89) NONCODE
- (90) TreeFam
- (91) PathCards
- (92) GeneReviews
- (93) GeneTex
- (94) Taconic Biosciences
- (95) GTEx
- (96) ProteomicsDB
- (97) SCBT
- (98) DGIdb
- (99) ClinicalTrials
- (100) RVIS
- (101) SIGNOR
- (102) diseasecard
- (103) NIH Rare Diseases
- (104) Orphanet
- (105) UMLS
- (106) GTR
- (107) Disease Ontology
- (108) MedlinePlus Genetics
- (109) MeSH
- (110) MedlinePlus
- (111) CDC
- (112) NINDS
- (113) NCBI Bookshelf
- (114) ClinVar
- (115) Gene Damage Index
- (116) HPO
- (117) UDN
- (118) VISTA
- (119) FANTOM5
- (120) ENCODE
- (121) ProSci
- (122) Horizon
- (123) The Signaling Pathways Project (SPP)
- (124) IID
- (125) VectorBuilder
- (126) SNPedia
- (127) BRCA Exchange
- (128) CIViC
- (129) ProteoGenix
- (130) dbSUPER
- (131) TISSUES
- (132) Gene ORGANizer
- (133) abm
- (134) Human Protein Atlas
- (135) GWAS Catalog
- (136) Monarch Initiative
- (137) DataMed
- (138) HumanCyc
- (139) UCNEbase
- (140) EPDnew
- (141) Applied Biosystems
- (142) GlyConnect
- (143) Aminode
- (144) GeneCopoeia
- (145) GPS-Prot
- (146) RNAcentral
- (147) LncRNADisease
- (148) LOVD
- (149) miR2Disease
- (150) DiseaseEnhancer
- (151) Boster Bio
- (152) Biorbyt
- (153) Biocompare
- (154) Mastermind
- (155) CTD^2 Dashboard
- (156) CraniofacialAtlas
- (157) GeneImprint
- (158) Synthego
- (159) ENA
- (160) GtRNAdb
- (161) LncBase
- (162) LncBook
- (163) LNCipedia
- (164) Modomics
- (165) PDBe
- (166) Rfam
- (167) SILVA
- (168) snOPY
- (169) SRPDB
- (170) GENCODE
- (171) TarBase
- (172) Open Targets Platform
- (173) 5SRRNADB
- (174) snoDB
- (175) MirGeneDB
- (176) Alliance of Genome Resources