Free for academic non-profit institutions. Other users need a Commercial license
Aliases for ZDHHC13 Gene
Aliases for ZDHHC13 Gene
- Zinc Finger DHHC-Type Containing 13 2 3 5
- Huntingtin-Interacting Protein 14-Related Protein 3 4
- Zinc Finger DHHC Domain-Containing Protein 13 3 4
- Putative NF-Kappa-B-Activating Protein 209 3 4
- Putative MAPK-Activating Protein PM03 3 4
- Palmitoyltransferase ZDHHC13 3 4
- HIP14-Related Protein 3 4
- DHHC-13 3 4
External Ids for ZDHHC13 Gene
- HGNC: 18413
- Entrez Gene: 54503
- Ensembl: ENSG00000177054
- OMIM: 612815
- UniProtKB: Q8IUH4
Previous GeneCards Identifiers for ZDHHC13 Gene
- GC11P019104
- GC11P018822
Summaries for ZDHHC13 Gene
GeneCards Summary for ZDHHC13 Gene
ZDHHC13 (Zinc Finger DHHC-Type Containing 13) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include obsolete signal transducer activity and palmitoyltransferase activity. An important paralog of this gene is ZDHHC17.
UniProtKB/Swiss-Prot Summary for ZDHHC13 Gene
-
Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.
Additional gene information for ZDHHC13 Gene
- Monarch Initiative
- Search for ZDHHC13 at DataMed
- Search for ZDHHC13 at HumanCyc
No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ZDHHC13 Gene
Genomics for ZDHHC13 Gene
GeneHancer (GH) Regulatory Elements for ZDHHC13 Gene
Promoters and enhancers for ZDHHC13 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around ZDHHC13 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the ZDHHC13 gene promoter:
-
- aMEF-2
- HEN1
- MEF-2
- MEF-2A
- NCX
- NF-kappaB
- NF-kappaB1
- NF-kappaB2
- TBP
Genomic Locations for ZDHHC13 Gene
Genomic Locations for ZDHHC13 Gene
- chr11:19,117,099-19,176,422
- (GRCh38/hg38)
- Size:
- 59,324 bases
- Orientation:
- Plus strand
- chr11:19,138,646-19,197,969
- (GRCh37/hg19)
- Size:
- 59,324 bases
- Orientation:
- Plus strand
Genomic View for ZDHHC13 Gene
Genes around ZDHHC13 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 11p15.1 by HGNC
- 11p15.1 by Entrez Gene
- 11p15.1 by Ensembl
ZDHHC13 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ZDHHC13 Gene
Proteins for ZDHHC13 Gene
-
Protein details for ZDHHC13 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q8IUH4-ZDH13_HUMAN
- Recommended name:
- Palmitoyltransferase ZDHHC13
- Protein Accession:
- Q8IUH4
- Q7Z2D3
- Q86VK2
- Q9NV30
- Q9NV99
Protein attributes for ZDHHC13 Gene
- Size:
- 622 amino acids
- Molecular mass:
- 70861 Da
- Quaternary structure:
-
- Interacts (via ANK repeats) with CLIP3 (PubMed:26198635). Interacts (via ANK repeats) with DNAJC5 (via C-terminus) (By similarity). Interacts (via ANK repeats) with HTT (PubMed:26198635). Interacts (via ANK repeats) with MAP6 (PubMed:26198635). Interacts (via ANK repeats) with SNAP23. Interacts (via ANK repeats) with SNAP25. May interact (via ANK repeats) with SPRED2 (By similarity).
- SequenceCaution:
-
- Sequence=BAA91856.1; Type=Erroneous termination; Positions=482; Note=Translated as Cys.; Evidence={ECO:0000305};
Protein Expression for ZDHHC13 Gene
Selected DME Specific Peptides for ZDHHC13 Gene
- Q8IUH4:
-
- KCELFLLL
- LHWAAIN
- KGETPLDMALQ
- QNLADFFQCGCFGLVKPC
- HQNTPLHWAVAAGNV
- AVDKLLEAGSSLDI
- DGEGFSSIHLAVLFQHMPIIAYLISK
- AFLYFFYKTWATDPGFTKASEEE
- LAETGSLD
- LPLIEDSSNCDIVKATQYGIFERCKELVEAGYDVRQPD
- HMKQTLSLRKTPYNLGF
- FHFSWSTFLL
- WTGRCIGFGNHH
- WIIYGSF
- KVIGPEPTGFLLKFNPSL
Post-translational modifications for ZDHHC13 Gene
Other Protein References for ZDHHC13 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- G Biosciences Immunotag™ ZDHHC13 Antibody
- Atlas Antibodies Anti-ZDHHC13 Antibody (HPA016759) and Anti-ZDHHC13 Antibody (HPA018791)
-
Custom Antibody ServicesOriGene Antibodies for ZDHHC13
- Novus Biologicals Antibodies for ZDHHC13
-
Abcam antibodies for ZDHHC13
- Invitrogen Antibodies for ZDHHC13 (AFLGC-ZDHHC13)
-
Biorbyt antibodies for ZDHHC13
Protein Products
- Atlas Antibodies PrEST Antigen ZDHHC13 (APrEST73322) and PrEST Antigen ZDHHC13 (APrEST73323)
-
OriGene Purified Proteins for ZDHHC13
- Search Origene for MassSpec and Protein Over-expression Lysates for ZDHHC13
- Origene Custom Protein Services for ZDHHC13
- antibodies-online: Show 3 available ZDHHC13 Proteins ranked by validation data
- Compare Top ZDHHC13 Proteins
-
Quality Products:
-
Abcam proteins for ZDHHC13
Domains & Families for ZDHHC13 Gene
Gene Families for ZDHHC13 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted membrane proteins
- Transporters
Protein Domains for ZDHHC13 Gene
- Blocks:
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for ZDHHC13 Gene
- GenScript: Design optimal peptide antigens:
-
- Zinc finger, DHHC-type containing 13, isoform CRA_b (C9JYJ4_HUMAN)
- Zinc finger DHHC domain-containing protein 13 (ZDH13_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q8IUH4UniProtKB/Swiss-Prot:
ZDH13_HUMAN :- The DHHC domain is required for palmitoyltransferase activity.
- Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
- Domain:
-
- The DHHC domain is required for palmitoyltransferase activity.
- Family:
-
- Belongs to the DHHC palmitoyltransferase family. AKR/ZDHHC17 subfamily.
Function for ZDHHC13 Gene
Molecular function for ZDHHC13 Gene
- UniProtKB/Swiss-Prot Function:
- Palmitoyltransferase for HTT and GAD2. May play a role in Mg(2+) transport.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]; Xref=Rhea:RHEA:36683, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11032, ChEBI:CHEBI:29950, ChEBI:CHEBI:57287, ChEBI:CHEBI:57379, ChEBI:CHEBI:74151; EC=2.3.1.225; Evidence=. ;.
Enzyme Numbers (IUBMB) for ZDHHC13 Gene
Phenotypes From GWAS Catalog for ZDHHC13 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005515 | protein binding | IEA | -- |
| GO:0015095 | magnesium ion transmembrane transporter activity | ISS | -- |
| GO:0016409 | palmitoyltransferase activity | ISS | -- |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016746 | transferase activity, transferring acyl groups | IEA | -- |
Phenotypes for ZDHHC13 Gene
- MGI mutant phenotypes for ZDHHC13:
-
inferred from 2 alleles
- cardiovascular system phenotype
- homeostasis/metabolism phenotype
- nervous system phenotype
- behavior/neurological phenotype
- integument phenotype
- mortality/aging
- cellular phenotype
- muscle phenotype
- liver/biliary system phenotype
- skeleton phenotype
- renal/urinary system phenotype
- adipose tissue phenotype
- hematopoietic system phenotype
- immune system phenotype
- growth/size/body region phenotype
- GenomeRNAi human phenotypes for ZDHHC13:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR Products
-
OriGene CRISPR knockouts for ZDHHC13
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ZDHHC13
- genomics-online: gRNA clones - Search for available ZDHHC13 gRNA products
- Overview of 113 available ZDHHC13 gene related products
- Applied Biological Materials (abm): CRISPR Clones for ZDHHC13 - Select products 50% OFF >
- * ZDHHC13 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * ZDHHC13 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
Santa Cruz Biotechnology (SCBT) CRISPR for ZDHHC13
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for ZDHHC13
- Browse OriGene Inhibitory RNA Products For ZDHHC13
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13
- genomics-online: shRNA clones - Search for available ZDHHC13 shRNA products
- Overview of 113 available ZDHHC13 gene related products
Clone Products
- Sino Biological Human cDNA Clone for ZDHHC13
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ZDHHC13
- Applied Biological Materials (abm): Clones for ZDHHC13 - Select products 50% OFF >
- * ZDHHC13 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * ZDHHC13 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
Cell Line Products
-
Horizon Cell Lines for ZDHHC13
No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for ZDHHC13 Gene
Localization for ZDHHC13 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ZDHHC13 Gene
- Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Low extracellular Mg(2+) induces increase in Golgi and in post-Golgi vesicles. {ECO:0000250 UniProtKB:Q9CWU2}.
| Compartment | Confidence |
|---|---|
| endoplasmic reticulum | 5 |
| golgi apparatus | 4 |
| plasma membrane | 3 |
| mitochondrion | 1 |
| peroxisome | 0 |
- Vesicles (4)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | ISS | -- |
| GO:0005783 | endoplasmic reticulum | IDA | 16647879 |
| GO:0005794 | Golgi apparatus | IEA | -- |
| GO:0016020 | membrane | HDA,IEA | 19946888 |
| GO:0016021 | integral component of membrane | IEA | -- |
Pathways & Interactions for ZDHHC13 Gene
Interacting Proteins for ZDHHC13 Gene
GPS-Prot Interaction Network for ZDHHC13
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling | HMP | 12761501 |
| GO:1903830 | magnesium ion transmembrane transport | IEA | -- |
No data available for Pathways by source and SIGNOR curated interactions for ZDHHC13 Gene
Drugs & Compounds for ZDHHC13 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Coenzyme A | Investigational | Nutra | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| hexadecanoyl-CoA |
|
|
Drug Products
- Atlas Antibodies PrEST Antigen ZDHHC13 (APrEST73322) and PrEST Antigen ZDHHC13 (APrEST73323)
Transcripts for ZDHHC13 Gene
mRNA/cDNA for ZDHHC13 Gene
- (2) REFSEQ mRNAs :
- (13) Additional mRNA sequences :
- (91) Selected AceView cDNA sequences:
- (8) Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000399351 2283 bps (ENST00000399351.7)
- ENST00000446113 2406 bps (ENST00000446113.6)
- ENST00000524744 433 bps (ENST00000524744.1)
- ENST00000525490 6304 bps (ENST00000525490.5)
- ENST00000530100 1279 bps (ENST00000530100.1)
CRISPR Products
-
OriGene CRISPR knockouts for ZDHHC13
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ZDHHC13
- genomics-online: gRNA clones - Search for available ZDHHC13 gRNA products
- Overview of 113 available ZDHHC13 gene related products
- Applied Biological Materials (abm): CRISPR Clones for ZDHHC13 - Select products 50% OFF >
- * ZDHHC13 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * ZDHHC13 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
Santa Cruz Biotechnology (SCBT) CRISPR for ZDHHC13
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for ZDHHC13
- Browse OriGene Inhibitory RNA Products For ZDHHC13
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13
- genomics-online: shRNA clones - Search for available ZDHHC13 shRNA products
- Overview of 113 available ZDHHC13 gene related products
Clone Products
- Sino Biological Human cDNA Clone for ZDHHC13
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ZDHHC13
- Applied Biological Materials (abm): Clones for ZDHHC13 - Select products 50% OFF >
- * ZDHHC13 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * ZDHHC13 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
| ExUns: | 1 | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13a | · | 13b | ^ | 14a | · | 14b | ^ | 15 | ^ | 16 | ^ | 17 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||||
| SP2: | - | - | |||||||||||||||||||||||||||||||||||
| SP3: | - | ||||||||||||||||||||||||||||||||||||
| SP4: |
Expression for ZDHHC13 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
mRNA differential expression in normal tissues according to GTEx for ZDHHC13 Gene
This gene is overexpressed in Esophagus - Mucosa (x5.1).
This gene is overexpressed in Nasal epithelium (62.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ZDHHC13 Gene
NURSA nuclear receptor signaling pathways regulating expression of ZDHHC13 Gene:
ZDHHC13SOURCE GeneReport for Unigene cluster for ZDHHC13 Gene:
Hs.188569Evidence on tissue expression from TISSUES for ZDHHC13 Gene
- Eye(4.1)
- Lung(4.1)
Primer Products
-
OriGene qPCR primer pairs for ZDHHC13
-
OriGene qPCR primer pairs and template standards for ZDHHC13
- genomics-online: primer clones - Search for available ZDHHC13 Primer products
- Overview of 113 available ZDHHC13 gene related products
Gene Expression Assay Products
No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ZDHHC13 Gene
Orthologs for ZDHHC13 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | ZDHHC13 33 32 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | ZDHHC13 33 32 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | ZDHHC13 33 32 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Zdhhc13 17 33 32 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Zdhhc13 32 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | ZDHHC13 33 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | ZDHHC13 33 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | ZDHHC13 33 32 |
|
OneToOne | |
| lizard (Anolis carolinensis) |
Reptilia | ZDHHC13 33 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | LOC100493145 32 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | zdhhc13 33 32 |
|
OneToOne | |
| wufi22e09 32 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | Hip14 33 |
|
OneToMany | |
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | AKR1 33 |
|
ManyToMany | |
| AKR2 33 |
|
ManyToMany | |||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.11093 33 |
|
OneToMany |
- Species where no ortholog for ZDHHC13 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Evolution for ZDHHC13 Gene
- ENSEMBL:
- Gene Tree for ZDHHC13 (if available)
- TreeFam:
- Gene Tree for ZDHHC13 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for ZDHHC13: view image
Paralogs for ZDHHC13 Gene
Variants for ZDHHC13 Gene
| SNP ID | Clin | Chr 11 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000128709 | -- | 19,142,796(+) | G/A/C | coding_sequence_variant, genic_upstream_transcript_variant, intron_variant, missense_variant, non_coding_transcript_variant | |
| rs1000131588 | -- | 19,138,152(+) | T/A | genic_upstream_transcript_variant, intron_variant | |
| rs1000241728 | -- | 19,133,159(+) | T/G | genic_upstream_transcript_variant, intron_variant | |
| rs1000273436 | -- | 19,162,376(+) | C/T | intron_variant | |
| rs1000295298 | -- | 19,143,877(+) | C/A | genic_upstream_transcript_variant, intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv2662583 | CNV | deletion | 23128226 |
| esv3428572 | CNV | insertion | 20981092 |
| esv3625530 | CNV | loss | 21293372 |
| esv3625531 | CNV | loss | 21293372 |
| nsv476084 | CNV | novel sequence insertion | 20440878 |
| nsv477679 | CNV | novel sequence insertion | 20440878 |
Residual Variation Intolerance Score:
27.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.13;
51.30% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for ZDHHC13 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- ZDHHC13
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ZDHHC13 Gene
Disorders for ZDHHC13 Gene
Additional Disease Information for ZDHHC13
- Genetic Association Database
- (GAD)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for ZDHHC13 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ZDHHC13 Gene
Publications for ZDHHC13 Gene
- Huntingtin-interacting proteins, HIP14 and HIP14L, mediate dual functions, palmitoyl acyltransferase and Mg2+ transport. (PMID: 18794299) Goytain A … Quamme GA (The Journal of biological chemistry 2008) 2 3 23 56
- Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 56
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 56
- Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways. (PMID: 12761501) Matsuda A … Sugano S (Oncogene 2003) 3 4 56
- HIP14, a novel ankyrin domain-containing protein, links huntingtin to intracellular trafficking and endocytosis. (PMID: 12393793) Singaraja RR … Hayden MR (Human molecular genetics 2002) 3 4 56
ExternalLinks
Products for ZDHHC13 Gene
- Custom Antibody ServicesOriGene Antibodies for ZDHHC13
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ZDHHC13
- Search Origene for MassSpec and Protein Over-expression Lysates for ZDHHC13
- Origene Custom Protein Services for ZDHHC13
- Origene sirna, shrna, and RNAi products in human, mouse, rat for ZDHHC13
- Browse OriGene Inhibitory RNA Products For ZDHHC13
- OriGene qPCR primer pairs for ZDHHC13
- OriGene qPCR primer pairs and template standards for ZDHHC13
- OriGene CRISPR knockouts for ZDHHC13
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ZDHHC13
- Sino Biological Human cDNA Clone for ZDHHC13
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for ZDHHC13
- Novus Biologicals proteins and lysates for ZDHHC13
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for ZDHHC13
- Abcam proteins for ZDHHC13
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for ZDHHC13 (AFLGC-ZDHHC13)
- antibodies-online: Show 15 available ZDHHC13 Antibodies ranked by validation data
- Compare Top ZDHHC13 Antibodies
- antibodies-online: Search results for available ZDHHC13 related products ranked by validation data
- antibodies-online: Show 3 available ZDHHC13 Proteins ranked by validation data
- Compare Top ZDHHC13 Proteins
- Quality Products:
- Horizon Cell Lines for ZDHHC13
- genomics-online: cdna clones - Search for available ZDHHC13 CDNA products
- Overview of 113 available ZDHHC13 gene related products
- orf clones - Search for available ZDHHC13 ORF products
- Overview of 113 available ZDHHC13 gene related products
- genomics-online: gRNA clones - Search for available ZDHHC13 gRNA products
- Overview of 113 available ZDHHC13 gene related products
- genomics-online: primer clones - Search for available ZDHHC13 Primer products
- Overview of 113 available ZDHHC13 gene related products
- genomics-online: shRNA clones - Search for available ZDHHC13 shRNA products
- Overview of 113 available ZDHHC13 gene related products
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ZDHHC13
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ZDHHC13
- Search GeneCopoeia for miRNA 3'UTR Target clone products for ZDHHC13
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ZDHHC13
- Biorbyt antibodies for ZDHHC13
Sources for ZDHHC13 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) CGAP SAGE
- (31) SOURCE
- (32) HomoloGene
- (33) PanEnsembl
- (34) euGenes
- (35) SGD
- (36) FlyBase
- (37) WormBase
- (38) Pseudogene
- (39) DGV
- (40) dbSNP
- (41) GenAtlas
- (42) HGMD
- (43) GAD
- (44) BGMUT
- (45) HuGE
- (46) Atlas
- (47) GenBank
- (48) H-invDB
- (49) HORDE
- (50) HUGE
- (51) IMGT
- (52) Leiden
- (53) miRBase
- (54) DME
- (55) OriGene
- (56) PubMed
- (57) R&D Systems
- (58) TGDB
- (59) Tocris
- (60) Abcam
- (61) Novus Biologicals
- (62) ProSpec
- (63) Sino Biological
- (64) GenScript
- (65) Qiagen
- (66) OCA
- (67) Proteopedia
- (68) MOPED
- (69) neXtProt
- (70) Reactome
- (71) GeneGo (Thomson Reuters)
- (72) DISEASES
- (73) SIMAP
- (74) GenomeRNAi
- (75) LifeMap
- (76) miRTarBase
- (77) MalaCards
- (78) Invitrogen
- (79) BitterDB
- (80) ESI-BIO
- (81) RefSeq
- (82) BioSystems
- (83) MaxQB
- (84) IUPHAR
- (85) BioGPS
- (86) Illumina
- (87) COMPARTMENTS
- (88) HOMER
- (89) PaxDb
- (90) ApexBio
- (91) Addgene
- (92) antibodies-online
- (93) CYP
- (94) NONCODE
- (95) TreeFam
- (96) PathCards
- (97) GeneReviews
- (98) GeneTex
- (99) Taconic Biosciences
- (100) GTEx
- (101) ProteomicsDB
- (102) SCBT
- (103) DGIdb
- (104) ClinicalTrials
- (105) RVIS
- (106) SIGNOR
- (107) diseasecard
- (108) NIH Rare Diseases
- (109) Orphanet
- (110) UMLS
- (111) GTR
- (112) Disease Ontology
- (113) Genetics Home Reference
- (114) MeSH
- (115) MedlinePlus
- (116) CDC
- (117) NINDS
- (118) NCBI Bookshelf
- (119) ClinVar
- (120) Gene Damage Index
- (121) HPO
- (122) UDN
- (123) VISTA
- (124) FANTOM5
- (125) ENCODE
- (126) ProSci
- (127) Horizon
- (128) NURSA
- (129) IID
- (130) VectorBuilder
- (131) SNPedia
- (132) BRCA Exchange
- (133) CIViC
- (134) ProteoGenix
- (135) dbSUPER
- (136) TISSUES
- (137) Gene ORGANizer
- (138) abm
- (139) Human Protein Atlas
- (140) GWAS Catalog
- (141) Monarch Initiative
- (142) DataMed
- (143) HumanCyc
- (144) genomics-online
- (145) UCNEbase
- (146) EPDnew
- (147) Applied Biosystems
- (148) GlyConnect
- (149) Aminode
- (150) GeneCopoeia
- (151) GPS-Prot
- (152) RNACentral
- (153) LncRNADisease
- (154) LOVD
- (155) miR2Disease
- (156) DiseaseEnhancer
- (157) Boster Bio
- (158) Biorbyt
- (159) Biocompare
- (160) Mastermind
- (161) CTD^2 Dashboard
- (162) CraniofacialAtlas
- (163) GeneImprint
- (164) Synthego
- (165) Bio Basic
- (166) ENA
- (167) GtRNAdb
- (168) LncBase
- (169) LncBook
- (170) LNCipedia
- (171) LncRNAdb
- (172) Modomics
- (173) PDBe
- (174) Rfam
- (175) SILVA
- (176) snOPY
- (177) SRPDB
- (178) GENCODE
- (179) TarBase
- (180) MyBioSource