This gene encodes a 5'-3' exonuclease that promotes transcription termination at cotranscriptional cleavage sites. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] See more...

Aliases for XRN2 Gene

Aliases for XRN2 Gene

  • 5'-3' Exoribonuclease 2 2 3 4 5
  • DHP Protein 3 4
  • Dhm1-Like Protein 3
  • DHM1-Like Protein 4
  • EC 3.1.13.- 4
  • EC 3.1.13 51
  • XRN2 5

External Ids for XRN2 Gene

Previous GeneCards Identifiers for XRN2 Gene

  • GC20P021272
  • GC20P021278
  • GC20P021231
  • GC20P021283

Summaries for XRN2 Gene

Entrez Gene Summary for XRN2 Gene

  • This gene encodes a 5'-3' exonuclease that promotes transcription termination at cotranscriptional cleavage sites. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

GeneCards Summary for XRN2 Gene

XRN2 (5'-3' Exoribonuclease 2) is a Protein Coding gene. Diseases associated with XRN2 include Amyotrophic Lateral Sclerosis 4, Juvenile and Corneal Dystrophy, Posterior Polymorphous, 1. Among its related pathways are rRNA processing in the nucleus and cytosol and Chaperonin-mediated protein folding. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and nuclease activity. An important paralog of this gene is XRN1.

UniProtKB/Swiss-Prot Summary for XRN2 Gene

  • Possesses 5'->3' exoribonuclease activity (By similarity). May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription. Binds to RNA polymerase II (RNAp II) transcription termination R-loops formed by G-rich pause sites (PubMed:21700224).

Gene Wiki entry for XRN2 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for XRN2 Gene

Genomics for XRN2 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for XRN2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH20J021302 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 600.7 +0.4 431 3.3 CEBPG HNRNPL CREB1 GATAD2A ATF7 PRDM10 ZNF629 TFE3 RFX1 SOX13 ENSG00000275457 XRN2 KIZ RF00017-3538 NKX2-4
GH20J021124 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 14.9 -177.1 -177069 2.5 SP1 HNRNPL CREB1 GATAD2A PRDM10 REST TFE3 IKZF1 NFKBIZ CTCF KIZ NONHSAG031413.2 RPS15AP1 XRN2 RPL24P2 RNA5SP477 RF00001-188
GH20J021512 Promoter/Enhancer 1.6 EPDnew Ensembl ENCODE dbSUPER 17.7 +210.4 210388 3.4 PRDM10 ZNF692 PATZ1 EZH2 KLF9 SP2 ZBTB10 ZSCAN5C BCL11A USF1 NKX2-2 XRN2 RPS15AP1 KIZ LOC112268271 NKX2-2-AS1
GH20J020742 Enhancer 1.3 FANTOM5 ENCODE CraniofacialAtlas dbSUPER 14.8 -559.2 -559206 2.6 REST ZNF692 FOXA1 SP1 CEBPA SOX13 RFX1 RNF2 FOXA2 TGIF2 HSALNG0129065 RPS15AP1 RALGAPA2 XRN2 RPL24P2 RPL12P12 CRNKL1 LOC105372555 piR-31470-301 KIZ
GH20J021508 Enhancer 1 ENCODE dbSUPER 15.2 +203.1 203125 0.2 CTCF HNRNPL ZNF692 ZNF143 ZSCAN4 REST EZH2 ZNF600 YY1 ZNF37A RPS15AP1 XRN2 RPL24P2 ENSG00000278041 LOC112268271 NKX2-4
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around XRN2 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for XRN2

Top Transcription factor binding sites by QIAGEN in the XRN2 gene promoter:
  • AML1a
  • AP-2rep
  • AREB6
  • c-Myb
  • C/EBPalpha
  • CREB
  • deltaCREB
  • Egr-2
  • HSF2
  • NRF-2

Genomic Locations for XRN2 Gene

Genomic Locations for XRN2 Gene
chr20:21,303,313-21,389,825
(GRCh38/hg38)
Size:
86,513 bases
Orientation:
Plus strand
chr20:21,283,942-21,370,463
(GRCh37/hg19)
Size:
86,522 bases
Orientation:
Plus strand

Genomic View for XRN2 Gene

Genes around XRN2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
XRN2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for XRN2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for XRN2 Gene

Proteins for XRN2 Gene

  • Protein details for XRN2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H0D6-XRN2_HUMAN
    Recommended name:
    5'-3' exoribonuclease 2
    Protein Accession:
    Q9H0D6
    Secondary Accessions:
    • Q3L8N4
    • Q6KGZ9
    • Q9BQL1
    • Q9NTW0
    • Q9NXS6
    • Q9UL53

    Protein attributes for XRN2 Gene

    Size:
    950 amino acids
    Molecular mass:
    108582 Da
    Quaternary structure:
    • Interacts with POLR2A and SMN1/SMN2 (PubMed:26700805). Interacts with CDKN2AIP and NKRF (PubMed:24462208). Interacts with CDKN2AIPNL; the interaction is direct (PubMed:26779609). Interacts with TRIM71 (via NHL repeats) in an RNA-dependent manner (PubMed:23125361).
    SequenceCaution:
    • Sequence=AAR24369.1; Type=Frameshift; Evidence={ECO:0000305}; Sequence=BAA90934.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};

    Alternative splice isoforms for XRN2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for XRN2 Gene

Selected DME Specific Peptides for XRN2 Gene

Q9H0D6:
  • DDWVFMCFF
  • FFVGNDFLPHLPSLEIR
  • FEKGTKPF
  • DPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPN
  • KERFDSNCITPGTEFMDNLAKCLRYYIADRLN
  • SPVPMLRDLTQN
  • AFRTLGH
  • EDEMMVA
  • EFDNLYLDMNGIIHPCTHPED
  • FRWLSRKYP
  • EDSDSEPEPEDN
  • DGVAPRAKMNQQRSRRFR
  • PQLGFNRDR
  • YVEGLCWVLRYYYQGC
  • WQGVALLPF
  • KECNGVK
  • LGLATHEP
  • PNTHHCL
  • DFYPEDF
  • YYYQGCASW
  • PAPKNEDEM
  • VNLQRVQMIMLAVGEVEDSIFKKRKDD

Post-translational modifications for XRN2 Gene

  • Ubiquitination at Lys172, Lys517, and Lys533
  • Modification sites at PhosphoSitePlus

Other Protein References for XRN2 Gene

Domains & Families for XRN2 Gene

Gene Families for XRN2 Gene

Human Protein Atlas (HPA):
  • Predicted intracellular proteins

Protein Domains for XRN2 Gene

InterPro:
Blocks:
  • C2HC-type zinc-finger signature
  • Putative 5-3 exonuclease domain
ProtoNet:

Suggested Antigen Peptide Sequences for XRN2 Gene

GenScript: Design optimal peptide antigens:
  • XRN2 protein (A2RRQ1_HUMAN)
  • cDNA FLJ55645, highly similar to 5'-3' exoribonuclease 2 (EC 3.1.11.-) (B4DZC3_HUMAN)
  • DHM1-like protein (XRN2_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9H0D6

UniProtKB/Swiss-Prot:

XRN2_HUMAN :
  • Belongs to the 5'-3' exonuclease family. XRN2/RAT1 subfamily.
Family:
  • Belongs to the 5'-3' exonuclease family. XRN2/RAT1 subfamily.
genes like me logo Genes that share domains with XRN2: view

Function for XRN2 Gene

Molecular function for XRN2 Gene

UniProtKB/Swiss-Prot Function:
Possesses 5'->3' exoribonuclease activity (By similarity). May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription. Binds to RNA polymerase II (RNAp II) transcription termination R-loops formed by G-rich pause sites (PubMed:21700224).
GENATLAS Biochemistry:
murine DHM1 gene homolog,5'-3' exoribonuclease 2,highly expressed in the testis,involved in homologous recomnbination

Enzyme Numbers (IUBMB) for XRN2 Gene

Phenotypes From GWAS Catalog for XRN2 Gene

Gene Ontology (GO) - Molecular Function for XRN2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000175 3'-5'-exoribonuclease activity EXP 23482395
GO:0001147 transcription termination site sequence-specific DNA binding IDA 21700224
GO:0003676 nucleic acid binding IEA --
GO:0003677 DNA binding IEA --
GO:0003723 RNA binding HDA,IBA 21873635
genes like me logo Genes that share ontologies with XRN2: view
genes like me logo Genes that share phenotypes with XRN2: view

Animal Model Products

  • Taconic Biosciences Mouse Models for XRN2

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for XRN2

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for XRN2 Gene

Localization for XRN2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for XRN2 Gene

Nucleus, nucleolus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for XRN2 gene
Compartment Confidence
nucleus 5
extracellular 2
mitochondrion 2
cytosol 2
plasma membrane 1
cytoskeleton 1
endoplasmic reticulum 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoli (4)
  • Nucleoplasm (4)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for XRN2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus TAS,IBA 21873635
GO:0005654 nucleoplasm TAS --
GO:0005730 nucleolus IEA,IDA 12429849
GO:0016020 membrane HDA 19946888
GO:0016235 aggresome IDA --
genes like me logo Genes that share ontologies with XRN2: view

Pathways & Interactions for XRN2 Gene

genes like me logo Genes that share pathways with XRN2: view

Pathways by source for XRN2 Gene

SIGNOR curated interactions for XRN2 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for XRN2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000738 DNA catabolic process, exonucleolytic IDA 15565158
GO:0000956 nuclear-transcribed mRNA catabolic process IBA 21873635
GO:0006139 nucleobase-containing compound metabolic process IEA --
GO:0006353 DNA-templated transcription, termination IEA --
GO:0006364 rRNA processing TAS --
genes like me logo Genes that share ontologies with XRN2: view

Drugs & Compounds for XRN2 Gene

No Compound Related Data Available

Transcripts for XRN2 Gene

mRNA/cDNA for XRN2 Gene

2 REFSEQ mRNAs :
19 NCBI additional mRNA sequence :
1 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for XRN2

Alternative Splicing Database (ASD) splice patterns (SP) for XRN2 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15a · 15b ^ 16 ^ 17a · 17b ^ 18 ^ 19 ^
SP1: - - -
SP2: - - - -
SP3: -
SP4: - - - - - - - - - - - - - - - - - - - - - -
SP5: -
SP6:
SP7:

ExUns: 20 ^ 21 ^ 22 ^ 23a · 23b ^ 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31a · 31b
SP1: -
SP2: -
SP3:
SP4: - - - - - - - - - -
SP5:
SP6:
SP7:

Relevant External Links for XRN2 Gene

GeneLoc Exon Structure for
XRN2

Expression for XRN2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for XRN2 Gene

Protein differential expression in normal tissues from HIPED for XRN2 Gene

This gene is overexpressed in Lymph node (12.1), Serum (10.5), and Peripheral blood mononuclear cells (6.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for XRN2 Gene



Protein tissue co-expression partners for XRN2 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for XRN2

SOURCE GeneReport for Unigene cluster for XRN2 Gene:

Hs.255932

mRNA Expression by UniProt/SwissProt for XRN2 Gene:

Q9H0D6-XRN2_HUMAN
Tissue specificity: Expressed in the spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Isoform 2 is expressed predominantly in peripheral blood leukocytes.

Evidence on tissue expression from TISSUES for XRN2 Gene

  • Liver(4.5)
  • Intestine(4.5)
  • Nervous system(4.4)
  • Lung(3.6)
  • Skin(2.7)
  • Kidney(2.6)
  • Heart(2.4)
  • Muscle(2.4)
  • Spleen(2.3)
  • Blood(2.3)
  • Thyroid gland(2.1)
genes like me logo Genes that share expression patterns with XRN2: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for XRN2 Gene

Orthologs for XRN2 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for XRN2 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia XRN2 30 31
  • 99.79 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia XRN2 30 31
  • 94.53 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Xrn2 30 17 31
  • 92.35 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia XRN2 30 31
  • 91.93 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia XRN2 31
  • 91 (a)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia XRN2 31
  • 91 (a)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Xrn2 30
  • 89.94 (n)
Chicken
(Gallus gallus)
Aves XRN2 30 31
  • 78.99 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia XRN2 31
  • 81 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia xrn2 30
  • 73.19 (n)
Str.1210 30
Zebrafish
(Danio rerio)
Actinopterygii xrn2 30 31
  • 68.21 (n)
OneToOne
idibd1090 30
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8562 30
Fruit Fly
(Drosophila melanogaster)
Insecta Rat1 30 31
  • 56.68 (n)
OneToOne
pcm 32
  • 44 (a)
CG10354 32
  • 44 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP004090 30
  • 54.89 (n)
Worm
(Caenorhabditis elegans)
Secernentea xrn-2 30 31
  • 57.91 (n)
OneToOne
Y48B6A.3 32
  • 54 (a)
Y39G8C.1 32
  • 36 (a)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes RAT1 30 31 33
  • 57.22 (n)
OneToOne
K. Lactis Yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0F07469g 30
  • 56.25 (n)
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_AGR303W 30
  • 51.23 (n)
Thale Cress
(Arabidopsis thaliana)
eudicotyledons XRN3 30
  • 54.79 (n)
Rice
(Oryza sativa)
Liliopsida Os01g0872700 30
  • 53.98 (n)
Os.19368 30
Wheat
(Triticum aestivum)
Liliopsida Ta.27926 30
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.10503 31
  • 57 (a)
OneToOne
Fission Yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes dhp1 30
  • 55.06 (n)
Bread mold
(Neurospora crassa)
Ascomycetes NCU01643 30
  • 53.91 (n)
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.2723 30
Species where no ortholog for XRN2 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for XRN2 Gene

ENSEMBL:
Gene Tree for XRN2 (if available)
TreeFam:
Gene Tree for XRN2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for XRN2: view image

Paralogs for XRN2 Gene

Paralogs for XRN2 Gene

(1) SIMAP similar genes for XRN2 Gene using alignment to 3 proteins:

  • XRN2_HUMAN
  • A2RRQ1_HUMAN
  • B4DZC3_HUMAN
genes like me logo Genes that share paralogs with XRN2: view

Variants for XRN2 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for XRN2 Gene

SNP ID Clinical significance and condition Chr 20 pos Variation AA Info Type
724653 Benign: not provided 21,333,776(+) G/A MISSENSE_VARIANT
rs6047420 - p.Arg925Cys
rs6137324 - p.Arg743Met

Additional dbSNP identifiers (rs#s) for XRN2 Gene

Structural Variations from Database of Genomic Variants (DGV) for XRN2 Gene

Variant ID Type Subtype PubMed ID
dgv2222n106 CNV deletion 24896259
dgv7517n54 CNV gain 21841781
esv1007546 CNV deletion 20482838
esv1596170 CNV deletion 17803354
esv22449 CNV gain 19812545
esv2276285 CNV deletion 18987734
esv2458583 CNV deletion 19546169
esv2579624 CNV loss 19546169
esv2722286 CNV deletion 23290073
esv3072679 CNV deletion 24192839
esv3556931 CNV deletion 23714750
esv3645493 CNV loss 21293372
esv7933 CNV loss 19470904
nsv1063280 CNV gain 25217958
nsv1070803 CNV deletion 25765185
nsv1125720 CNV tandem duplication 24896259
nsv1151460 CNV deletion 26484159
nsv179550 CNV deletion 16902084
nsv512606 CNV loss 21212237
nsv514936 CNV loss 21397061
nsv585706 CNV loss 21841781
nsv585710 CNV gain 21841781
nsv585711 CNV loss 21841781
nsv585712 CNV loss 21841781
nsv585713 CNV loss 21841781
nsv820835 CNV deletion 20802225
nsv955127 CNV deletion 24416366

Variation tolerance for XRN2 Gene

Residual Variation Intolerance Score: 6.51% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.64; 45.53% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for XRN2 Gene

Human Gene Mutation Database (HGMD)
XRN2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
XRN2

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for XRN2 Gene

Disorders for XRN2 Gene

MalaCards: The human disease database

(4) MalaCards diseases for XRN2 Gene - From: DISEASES

- elite association - COSMIC cancer census association via MalaCards
Search XRN2 in MalaCards View complete list of genes associated with diseases
genes like me logo Genes that share disorders with XRN2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for XRN2 Gene

Publications for XRN2 Gene

  1. Cloning and mapping of the XRN2 gene to human chromosome 20p11.1-p11.2. (PMID: 10409438) Zhang M … Zhao S (Genomics 1999) 2 3 4 23
  2. A novel splice variant of human XRN2 gene is mainly expressed in blood leukocyte. (PMID: 16147866) Li J … Mao Y (DNA sequence : the journal of DNA sequencing and mapping 2005) 3 4 23
  3. SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination. (PMID: 26700805) Zhao DY … Greenblatt JF (Nature 2016) 3 4
  4. Structural basis and function of XRN2 binding by XTB domains. (PMID: 26779609) Richter H … Großhans H (Nature structural & molecular biology 2016) 3 4
  5. The mammalian TRIM-NHL protein TRIM71/LIN-41 is a repressor of mRNA function. (PMID: 23125361) Loedige I … Filipowicz W (Nucleic acids research 2013) 3 4

Products for XRN2 Gene

  • Signalway Proteins for XRN2

Sources for XRN2 Gene