This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. This VPS protein ... See more...

Aliases for VPS29 Gene

Aliases for VPS29 Gene

  • VPS29 Retromer Complex Component 2 3 5
  • Vacuolar Protein Sorting-Associated Protein 29 3 4
  • Vesicle Protein Sorting 29 3 4
  • PEP11 Homolog 3 4
  • HVPS29 3 4
  • PEP11 2 3
  • DC15 2 3
  • DC7 2 3
  • Vacuolar Protein Sorting 29 Homolog (S. Cerevisiae) 2
  • Epididymis Secretory Sperm Binding Protein 3
  • Vacuolar Sorting Protein VPS29/PEP11 3
  • Vacuolar Protein Sorting 29 Homolog 3
  • VPS29, Retromer Complex Component 2
  • Retromer Protein 3
  • X 007 Protein 3
  • EC 3.1.3.3 51
  • VPS29 5

External Ids for VPS29 Gene

Previous GeneCards Identifiers for VPS29 Gene

  • GC12M109953
  • GC12M110725
  • GC12M110771
  • GC12M109341
  • GC12M109392
  • GC12M110929
  • GC12M107947

Summaries for VPS29 Gene

Entrez Gene Summary for VPS29 Gene

  • This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. This VPS protein may be involved in the formation of the inner shell of the retromer coat for retrograde vesicles leaving the prevacuolar compartment. Alternative splice variants encoding different isoforms and representing non-protein coding transcripts have been found for this gene. [provided by RefSeq, Aug 2013]

GeneCards Summary for VPS29 Gene

VPS29 (VPS29 Retromer Complex Component) is a Protein Coding gene. Diseases associated with VPS29 include Spastic Paraplegia 36, Autosomal Dominant and Ornithosis. Among its related pathways are Neuroscience and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include protein transporter activity and phosphoserine phosphatase activity.

UniProtKB/Swiss-Prot Summary for VPS29 Gene

  • Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde endosome-to-TGN transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. Required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA) (PubMed:15247922, PubMed:21725319, PubMed:23563491). Acts also as component of the retriever complex. The retriever complex is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1) (PubMed:28892079). In the endosomes, retriever complex drives the retrieval and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell surface proteins associated with processes that include cell migration, cell adhesion, nutrient supply and cell signaling (PubMed:28892079). The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes (PubMed:28892079). Involved in GLUT1 endosome-to-plasma membrane trafficking; the function is dependent of association with ANKRD27 (PubMed:24856514).
  • (Microbial infection) The heterotrimeric retromer cargo-selective complex (CSC) mediates the exit of human papillomavirus from the early endosome and the delivery to the Golgi apparatus.

Gene Wiki entry for VPS29 Gene

Additional gene information for VPS29 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for VPS29 Gene

Genomics for VPS29 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for VPS29 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH12J110499 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 600.7 +1.1 1102 4 ZNF221 BRCA1 RNF2 SP1 HNRNPL CREB1 GATAD2A TEAD4 PRDM10 ZNF629 ENSG00000278993 RAD9B VPS29 lnc-GPN3-3 IFT81 ARPC3 FAM216A ANAPC7 GPN3 ANKRD13A
GH12J111215 Enhancer 0.3 Ensembl 4.9 -714.9 -714861 2 MYC MAX VPS29 RF00017-1271 HSALNG0094030 PHETA1 CUX2
GH12J110542 Promoter/Enhancer 1.4 Ensembl ENCODE dbSUPER 0.3 -42.8 -42832 5 PRDM10 ZNF629 ZNF692 BACH1 FOXA1 STAT3 PRDM1 ZIC2 PATZ1 IKZF2 HVCN1 TCTN1 FAM216A RF00017-1266 piR-48759-069 PPTC7 VPS29
GH12J110531 Enhancer 1.2 Ensembl ENCODE dbSUPER 0.3 -30.9 -30861 3.2 SP1 BACH1 FOXA1 STAT3 JUND RELA TCF12 IKZF2 TRIM22 PKNOX1 FAM216A TCTN1 piR-48759-069 RF00017-1266 VPS29 RAD9B PPTC7
GH12J110536 Enhancer 1.1 Ensembl ENCODE dbSUPER 0.3 -36.1 -36123 3.5 PRDM10 ZNF629 ZNF692 PRDM1 ZIC2 PATZ1 SP1 ZNF501 ZNF600 SCRT2 ARPC3 TCTN1 GLTP GPN3 RF00017-1266 piR-48759-069 VPS29 PPTC7
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around VPS29 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for VPS29

Top Transcription factor binding sites by QIAGEN in the VPS29 gene promoter:
  • AML1a
  • AREB6
  • Egr-2
  • Evi-1
  • FOXJ2
  • FOXJ2 (long isoform)
  • GATA-1
  • GR
  • GR-alpha
  • RSRFC4

Genomic Locations for VPS29 Gene

Genomic Locations for VPS29 Gene
chr12:110,491,083-110,502,140
(GRCh38/hg38)
Size:
11,058 bases
Orientation:
Minus strand
chr12:110,928,902-110,939,922
(GRCh37/hg19)
Size:
11,021 bases
Orientation:
Minus strand

Genomic View for VPS29 Gene

Genes around VPS29 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
VPS29 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for VPS29 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for VPS29 Gene

Proteins for VPS29 Gene

  • Protein details for VPS29 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UBQ0-VPS29_HUMAN
    Recommended name:
    Vacuolar protein sorting-associated protein 29
    Protein Accession:
    Q9UBQ0
    Secondary Accessions:
    • Q502Y5
    • Q6FIF8
    • Q6IAH3
    • Q9H0W0
    • Q9NRP1
    • Q9NRU7

    Protein attributes for VPS29 Gene

    Size:
    182 amino acids
    Molecular mass:
    20506 Da
    Quaternary structure:
    • Component of the heterotrimeric retromer cargo-selective complex (CSC), also described as vacuolar protein sorting subcomplex (VPS), formed by VPS26 (VPS26A or VPS26B), VPS29 and VPS35 (PubMed:11102511, PubMed:16737443, PubMed:17891154, PubMed:28892079). The CSC has a highly elongated structure with VPS26 and VPS29 binding independently at opposite distal ends of VPS35 as central platform (By similarity). The CSC is believed to associate with variable sorting nexins to form functionally distinct retromer complex variants. The originally described retromer complex (also called SNX-BAR retromer) is a pentamer containing the CSC and a heterodimeric membrane-deforming subcomplex formed between SNX1 or SNX2 and SNX5 or SNX6 (also called SNX-BAR subcomplex); the respective CSC and SNX-BAR subcomplexes associate with low affinity. The CSC associates with SNX3 to form a SNX3-retromer complex. The CSC associates with SNX27, the WASH complex and the SNX-BAR subcomplex to form the SNX27-retromer complex (PubMed:21725319, PubMed:23563491). Component of the heterotrimeric retriever complex formed by VPS26C, VPS29 and VPS35L (PubMed:28892079). Interacts with VPS26A, VPS35, SNX1, SNX2, SNX27, WASHC5, TBC1D5 (PubMed:11102511, PubMed:20923837, PubMed:23331060, PubMed:23563491, PubMed:28892079). Interacts with VPS26B and ANKRD27 (By similarity).
    • (Microbial infection) Interacts with human papillomavirus 16 minor capsid protein L2 (via C-terminus); this interaction mediates the transport of the capsid from the early endosome to the Golgi apparatus.

    Three dimensional structures from OCA and Proteopedia for VPS29 Gene

    Alternative splice isoforms for VPS29 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for VPS29 Gene

Selected DME Specific Peptides for VPS29 Gene

Q9UBQ0:
  • FKKLLVP
  • KIQHILCTGNL
  • DVHIVRGD
  • DVDILISGHT
  • NIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKK
  • NPGSATGA

Post-translational modifications for VPS29 Gene

  • Ubiquitination at Lys30 and Lys50
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Abcam antibodies for VPS29
  • Boster Bio Antibodies for VPS29
  • Santa Cruz Biotechnology (SCBT) Antibodies for VPS29

Domains & Families for VPS29 Gene

Gene Families for VPS29 Gene

HGNC:
Human Protein Atlas (HPA):
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for VPS29 Gene

InterPro:
Blocks:
  • Protein of unknown function UPF0025
ProtoNet:

Suggested Antigen Peptide Sequences for VPS29 Gene

GenScript: Design optimal peptide antigens:
  • Vacuolar protein sorting-associated protein 29 (E9RKB4_HUMAN)
  • VPS29 protein (Q05DG7_HUMAN)
  • VPS29 protein (Q8N0S8_HUMAN)
  • Vesicle protein sorting 29 (VPS29_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9UBQ0

UniProtKB/Swiss-Prot:

VPS29_HUMAN :
  • Belongs to the VPS29 family.
Family:
  • Belongs to the VPS29 family.
genes like me logo Genes that share domains with VPS29: view

Function for VPS29 Gene

Molecular function for VPS29 Gene

UniProtKB/Swiss-Prot Function:
Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde endosome-to-TGN transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. Required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA) (PubMed:15247922, PubMed:21725319, PubMed:23563491). Acts also as component of the retriever complex. The retriever complex is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1) (PubMed:28892079). In the endosomes, retriever complex drives the retrieval and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell surface proteins associated with processes that include cell migration, cell adhesion, nutrient supply and cell signaling (PubMed:28892079). The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes (PubMed:28892079). Involved in GLUT1 endosome-to-plasma membrane trafficking; the function is dependent of association with ANKRD27 (PubMed:24856514).
UniProtKB/Swiss-Prot Function:
(Microbial infection) The heterotrimeric retromer cargo-selective complex (CSC) mediates the exit of human papillomavirus from the early endosome and the delivery to the Golgi apparatus.

Enzyme Numbers (IUBMB) for VPS29 Gene

Gene Ontology (GO) - Molecular Function for VPS29 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 11102511
GO:0046872 metal ion binding IEA --
genes like me logo Genes that share ontologies with VPS29: view
genes like me logo Genes that share phenotypes with VPS29: view

Animal Model Products

  • Taconic Biosciences Mouse Models for VPS29

CRISPR Products

miRNA for VPS29 Gene

miRTarBase miRNAs that target VPS29

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for VPS29

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for VPS29 Gene

Localization for VPS29 Gene

Subcellular locations from UniProtKB/Swiss-Prot for VPS29 Gene

Cytoplasm. Membrane. Peripheral membrane protein. Endosome membrane. Peripheral membrane protein. Early endosome. Late endosome.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for VPS29 gene
Compartment Confidence
endosome 5
cytosol 5
golgi apparatus 3
plasma membrane 2
cytoskeleton 2
mitochondrion 2
nucleus 2
endoplasmic reticulum 2
lysosome 2
extracellular 1
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Vesicles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for VPS29 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005768 endosome IDA --
GO:0005769 early endosome IEA --
GO:0005770 late endosome IEA --
GO:0005829 cytosol IEA,TAS --
genes like me logo Genes that share ontologies with VPS29: view

Pathways & Interactions for VPS29 Gene

genes like me logo Genes that share pathways with VPS29: view

Pathways by source for VPS29 Gene

1 KEGG pathway for VPS29 Gene
1 Cell Signaling Technology pathway for VPS29 Gene

Gene Ontology (GO) - Biological Process for VPS29 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006886 intracellular protein transport IBA 21873635
GO:0010506 NOT regulation of autophagy IMP 24603492
GO:0015031 protein transport IEA --
GO:0016032 viral process IEA --
GO:0016055 Wnt signaling pathway TAS --
genes like me logo Genes that share ontologies with VPS29: view

No data available for SIGNOR curated interactions for VPS29 Gene

Drugs & Compounds for VPS29 Gene

(2) Drugs for VPS29 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
genes like me logo Genes that share compounds with VPS29: view

Transcripts for VPS29 Gene

mRNA/cDNA for VPS29 Gene

4 REFSEQ mRNAs :
29 NCBI additional mRNA sequence :
12 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for VPS29

Alternative Splicing Database (ASD) splice patterns (SP) for VPS29 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6a · 6b · 6c · 6d ^ 7a · 7b · 7c ^ 8a · 8b
SP1: - - - - - - -
SP2: - - - - - -
SP3: - - - - - - - -
SP4: - - - - - - -
SP5: - - -
SP6:
SP7: - - - -
SP8:
SP9: - - -
SP10:

Relevant External Links for VPS29 Gene

GeneLoc Exon Structure for
VPS29

Expression for VPS29 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for VPS29 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for VPS29 Gene



Protein tissue co-expression partners for VPS29 Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for VPS29

SOURCE GeneReport for Unigene cluster for VPS29 Gene:

Hs.600114

mRNA Expression by UniProt/SwissProt for VPS29 Gene:

Q9UBQ0-VPS29_HUMAN
Tissue specificity: Ubiquitous. Highly expressed in heart, lung, placenta, spleen, peripheral blood leukocytes, thymus, colon skeletal muscle, kidney and brain.

Evidence on tissue expression from TISSUES for VPS29 Gene

  • Nervous system(4.8)
  • Lung(4.7)
  • Lymph node(4.5)
  • Liver(4.5)
  • Spleen(4.5)
  • Thyroid gland(4.5)
  • Blood(4.5)
  • Skin(3.2)
  • Kidney(2.9)
  • Intestine(2.7)
  • Pancreas(2.6)
  • Muscle(2.5)
  • Heart(2.4)
  • Stomach(2.2)
  • Bone marrow(2.2)
genes like me logo Genes that share expression patterns with VPS29: view

No data available for mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for VPS29 Gene

Orthologs for VPS29 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for VPS29 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia VPS29 30 31
  • 99.69 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia VPS29 31
  • 99 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia VPS29 31
  • 97 (a)
OneToOne
Dog
(Canis familiaris)
Mammalia VPS29 30 31
  • 96.01 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia VPS29 30 31
  • 95.47 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Vps29 30
  • 91.11 (n)
Mouse
(Mus musculus)
Mammalia Vps29 30 17 31
  • 90.19 (n)
OneToOne
Chicken
(Gallus gallus)
Aves VPS29 30 31
  • 85.33 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia -- 31
  • 97 (a)
OneToMany
-- 31
  • 90 (a)
OneToMany
-- 31
  • 85 (a)
OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia vps29 30
  • 82.41 (n)
Str.3938 30
Zebrafish
(Danio rerio)
Actinopterygii vps29 30 31
  • 79.07 (n)
OneToOne
wufb06g05 30
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.9310 30
Fruit Fly
(Drosophila melanogaster)
Insecta CG4764 30 31 32
  • 70.93 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP002338 30
  • 70 (n)
Worm
(Caenorhabditis elegans)
Secernentea vps-29 30 31
  • 61.51 (n)
OneToOne
ZK1128.8 32
  • 60 (a)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes VPS29 31 33
  • 29 (a)
OneToOne
Thale Cress
(Arabidopsis thaliana)
eudicotyledons MAG1 30
  • 62.06 (n)
Rice
(Oryza sativa)
Liliopsida Os02g0265400 30
  • 62.04 (n)
Os.10198 30
Barley
(Hordeum vulgare)
Liliopsida Hv.3466 30
Corn
(Zea mays)
Liliopsida Zm.8987 30
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.866 31
  • 76 (a)
OneToOne
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.8907 30
Species where no ortholog for VPS29 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for VPS29 Gene

ENSEMBL:
Gene Tree for VPS29 (if available)
TreeFam:
Gene Tree for VPS29 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for VPS29: view image

Paralogs for VPS29 Gene

(2) SIMAP similar genes for VPS29 Gene using alignment to 4 proteins:

  • VPS29_HUMAN
  • F8VXU5_HUMAN
  • Q05DG7_HUMAN
  • Q8N0S8_HUMAN
genes like me logo Genes that share paralogs with VPS29: view

No data available for Paralogs for VPS29 Gene

Variants for VPS29 Gene

Additional dbSNP identifiers (rs#s) for VPS29 Gene

Structural Variations from Database of Genomic Variants (DGV) for VPS29 Gene

Variant ID Type Subtype PubMed ID
nsv826512 CNV loss 20364138

Variation tolerance for VPS29 Gene

Residual Variation Intolerance Score: 44% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.19; 4.19% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for VPS29 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
VPS29

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for VPS29 Gene

Disorders for VPS29 Gene

MalaCards: The human disease database

(5) MalaCards diseases for VPS29 Gene - From: DISEASES

Disorder Aliases PubMed IDs
spastic paraplegia 36, autosomal dominant
  • spg36
ornithosis
  • psittacosis
ritscher-schinzel syndrome
  • craniocerebellocardiac dysplasia
legionnaire disease
  • legionnaire disease, susceptibility to
parkinson disease, late-onset
  • pd
- elite association - COSMIC cancer census association via MalaCards
Search VPS29 in MalaCards View complete list of genes associated with diseases
genes like me logo Genes that share disorders with VPS29: view

No data available for UniProtKB/Swiss-Prot and Genatlas for VPS29 Gene

Publications for VPS29 Gene

  1. Human homologues of yeast vacuolar protein sorting 29 and 35. (PMID: 11062004) Edgar AJ … Polak JM (Biochemical and biophysical research communications 2000) 2 3 4 23
  2. VPS29 is not an active metallo-phosphatase but is a rigid scaffold required for retromer interaction with accessory proteins. (PMID: 21629666) Swarbrick JD … Collins BM (PloS one 2011) 2 3 4
  3. The human Vps29 retromer component is a metallo-phosphoesterase for a cation-independent mannose 6-phosphate receptor substrate peptide. (PMID: 16737443) Damen E … van Leeuwen JE (The Biochemical journal 2006) 3 4 23
  4. Crystal structure of human vacuolar protein sorting protein 29 reveals a phosphodiesterase/nuclease-like fold and two protein-protein interaction sites. (PMID: 15788412) Wang D … Liu P (The Journal of biological chemistry 2005) 3 4 23
  5. Retriever is a multiprotein complex for retromer-independent endosomal cargo recycling. (PMID: 28892079) McNally KE … Cullen PJ (Nature cell biology 2017) 3 4

Products for VPS29 Gene

Sources for VPS29 Gene