This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. [provided by RefSeq, Feb 2012] See more...

Aliases for UBE2Z Gene

Aliases for UBE2Z Gene

  • Ubiquitin Conjugating Enzyme E2 Z 2 3 5
  • Uba6-Specific E2 Conjugating Enzyme 1 3 4
  • Ubiquitin-Conjugating Enzyme E2 Z 3 4
  • E2 Ubiquitin-Conjugating Enzyme Z 3 4
  • Ubiquitin Carrier Protein Z 3 4
  • Ubiquitin-Protein Ligase Z 3 4
  • UBA6-Specific Enzyme E2 2 3
  • Ubiquitin Conjugating Enzyme E2Z 3
  • Ubiquitin-Conjugating Enzyme E2Z 2
  • EC 6.3.2.19 52
  • EC 2.3.2.23 4
  • HOYS7 3
  • USE1 3
  • Use1 4

External Ids for UBE2Z Gene

Previous GeneCards Identifiers for UBE2Z Gene

  • GC17P044341
  • GC17P046985
  • GC17P042357

Summaries for UBE2Z Gene

Entrez Gene Summary for UBE2Z Gene

  • This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. [provided by RefSeq, Feb 2012]

GeneCards Summary for UBE2Z Gene

UBE2Z (Ubiquitin Conjugating Enzyme E2 Z) is a Protein Coding gene. Diseases associated with UBE2Z include Diabetes Mellitus, Insulin-Dependent, 19. Among its related pathways are Metabolism of proteins and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include ligase activity and ubiquitin protein ligase activity. An important paralog of this gene is UBE2O.

UniProtKB/Swiss-Prot Summary for UBE2Z Gene

  • Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.

Additional gene information for UBE2Z Gene

No data available for CIViC Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for UBE2Z Gene

Genomics for UBE2Z Gene

GeneHancer (GH) Regulatory Elements for UBE2Z Gene

Promoters and enhancers for UBE2Z Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around UBE2Z on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for UBE2Z

Top Transcription factor binding sites by QIAGEN in the UBE2Z gene promoter:
  • ARP-1
  • Bach2
  • Chx10
  • Evi-1
  • GR
  • HSF2
  • Ik-1
  • Pax-5
  • PPAR-alpha
  • RREB-1

Genomic Locations for UBE2Z Gene

Genomic Locations for UBE2Z Gene
chr17:48,908,369-48,929,060
(GRCh38/hg38)
Size:
20,692 bases
Orientation:
Plus strand
chr17:46,985,731-47,006,422
(GRCh37/hg19)
Size:
20,692 bases
Orientation:
Plus strand

Genomic View for UBE2Z Gene

Genes around UBE2Z on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UBE2Z Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UBE2Z Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UBE2Z Gene

Proteins for UBE2Z Gene

  • Protein details for UBE2Z Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H832-UBE2Z_HUMAN
    Recommended name:
    Ubiquitin-conjugating enzyme E2 Z
    Protein Accession:
    Q9H832
    Secondary Accessions:
    • A6N8M6
    • A6NC60
    • Q7L354
    • Q8TCM4
    • Q9H893

    Protein attributes for UBE2Z Gene

    Size:
    354 amino acids
    Molecular mass:
    38210 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAH15890.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAB14724.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for UBE2Z Gene

    Alternative splice isoforms for UBE2Z Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for UBE2Z Gene

Selected DME Specific Peptides for UBE2Z Gene

Q9H832:
  • MQDPFGEKRGHFDYQSLL
  • GDSKNYNECIRHETIRVAVC
  • SSVLISIQSLMTENPYHNEPGFEQERH
  • FRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLS

Post-translational modifications for UBE2Z Gene

  • Ubiquitination at Lys166
  • Modification sites at PhosphoSitePlus

Other Protein References for UBE2Z Gene

Domains & Families for UBE2Z Gene

Gene Families for UBE2Z Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for UBE2Z Gene

Blocks:
  • Ubiquitin-conjugating enzymes
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for UBE2Z Gene

GenScript: Design optimal peptide antigens:
  • Ubiquitin-conjugating enzyme E2Z (Putative), isoform CRA_a (D3DTW2_HUMAN)
  • Ubiquitin-protein ligase Z (UBE2Z_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9H832

UniProtKB/Swiss-Prot:

UBE2Z_HUMAN :
  • Belongs to the ubiquitin-conjugating enzyme family.
Family:
  • Belongs to the ubiquitin-conjugating enzyme family.
genes like me logo Genes that share domains with UBE2Z: view

Function for UBE2Z Gene

Molecular function for UBE2Z Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.; EC=2.3.2.23; Evidence=. ;.

Enzyme Numbers (IUBMB) for UBE2Z Gene

Phenotypes From GWAS Catalog for UBE2Z Gene

Gene Ontology (GO) - Molecular Function for UBE2Z Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004869 cysteine-type endopeptidase inhibitor activity IBA 21873635
GO:0005515 protein binding IPI 16189514
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
GO:0061631 ubiquitin conjugating enzyme activity IEA,IBA 21873635
genes like me logo Genes that share ontologies with UBE2Z: view
genes like me logo Genes that share phenotypes with UBE2Z: view

Animal Model Products

CRISPR Products

miRNA for UBE2Z Gene

miRTarBase miRNAs that target UBE2Z

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for UBE2Z Gene

Localization for UBE2Z Gene

Subcellular locations from UniProtKB/Swiss-Prot for UBE2Z Gene

Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UBE2Z gene
Compartment Confidence
nucleus 5
cytosol 4
extracellular 2
cytoskeleton 1
mitochondrion 1
plasma membrane 0
peroxisome 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for UBE2Z Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA,IBA 17464193
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with UBE2Z: view

Pathways & Interactions for UBE2Z Gene

genes like me logo Genes that share pathways with UBE2Z: view

Pathways by source for UBE2Z Gene

UniProtKB/Swiss-Prot Q9H832-UBE2Z_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for UBE2Z Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006511 ubiquitin-dependent protein catabolic process IBA,IEA 21873635
GO:0006915 apoptotic process IEA --
GO:0010951 negative regulation of endopeptidase activity IEA --
GO:0016567 protein ubiquitination TAS --
GO:0043065 positive regulation of apoptotic process IDA 17464193
genes like me logo Genes that share ontologies with UBE2Z: view

No data available for SIGNOR curated interactions for UBE2Z Gene

Drugs & Compounds for UBE2Z Gene

(3) Drugs for UBE2Z Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for UBE2Z Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8
genes like me logo Genes that share compounds with UBE2Z: view

Transcripts for UBE2Z Gene

mRNA/cDNA for UBE2Z Gene

1 REFSEQ mRNAs :
15 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for UBE2Z Gene

ExUns: 1 ^ 2a · 2b · 2c ^ 3a · 3b ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7a · 7b
SP1: - - - -
SP2: - - -
SP3: -
SP4:
SP5: - -

Relevant External Links for UBE2Z Gene

GeneLoc Exon Structure for
UBE2Z

Expression for UBE2Z Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for UBE2Z Gene

Protein differential expression in normal tissues from HIPED for UBE2Z Gene

This gene is overexpressed in Uterus (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for UBE2Z Gene



Protein tissue co-expression partners for UBE2Z Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for UBE2Z

SOURCE GeneReport for Unigene cluster for UBE2Z Gene:

Hs.514297

mRNA Expression by UniProt/SwissProt for UBE2Z Gene:

Q9H832-UBE2Z_HUMAN
Tissue specificity: Widely expressed. Highly in placenta, pancreas, spleen and testis.

Evidence on tissue expression from TISSUES for UBE2Z Gene

  • Nervous system(4.8)
  • Skin(4.4)
  • Thyroid gland(4.3)
  • Pancreas(4.2)
  • Lung(2.4)
genes like me logo Genes that share expression patterns with UBE2Z: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2Z Gene

Orthologs for UBE2Z Gene

This gene was present in the common ancestor of chordates.

Orthologs for UBE2Z Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia UBE2Z 31 30
  • 99.19 (n)
OneToOne
dog
(Canis familiaris)
Mammalia UBE2Z 31
  • 99 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia UBE2Z 31
  • 97 (a)
OneToOne
cow
(Bos Taurus)
Mammalia UBE2Z 31 30
  • 95.57 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Ube2z 30
  • 93.31 (n)
mouse
(Mus musculus)
Mammalia Ube2z 17 31 30
  • 93.22 (n)
oppossum
(Monodelphis domestica)
Mammalia UBE2Z 31
  • 92 (a)
OneToOne
chicken
(Gallus gallus)
Aves UBE2Z 31 30
  • 82.28 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia UBE2Z 31
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ube2z 30
  • 76.75 (n)
Str.10246 30
African clawed frog
(Xenopus laevis)
Amphibia MGC69155 30
zebrafish
(Danio rerio)
Actinopterygii ube2z 31 30
  • 72.94 (n)
OneToOne
Dr.28857 30
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8725 30
Species where no ortholog for UBE2Z was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for UBE2Z Gene

ENSEMBL:
Gene Tree for UBE2Z (if available)
TreeFam:
Gene Tree for UBE2Z (if available)
Aminode:
Evolutionary constrained regions (ECRs) for UBE2Z: view image

Paralogs for UBE2Z Gene

(12) SIMAP similar genes for UBE2Z Gene using alignment to 7 proteins:

  • UBE2Z_HUMAN
  • D3DTW2_HUMAN
  • D6RB11_HUMAN
  • H0Y9X8_HUMAN
  • I3L286_HUMAN
  • I3L3V3_HUMAN
  • I3L4C5_HUMAN
genes like me logo Genes that share paralogs with UBE2Z: view

Variants for UBE2Z Gene

Additional dbSNP identifiers (rs#s) for UBE2Z Gene

Structural Variations from Database of Genomic Variants (DGV) for UBE2Z Gene

Variant ID Type Subtype PubMed ID
esv3640729 CNV loss 21293372
nsv1112711 CNV deletion 24896259
nsv2073 CNV insertion 18451855
nsv482969 CNV loss 15286789
nsv833472 CNV gain 17160897

Variation tolerance for UBE2Z Gene

Residual Variation Intolerance Score: 33% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.05; 1.03% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for UBE2Z Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
UBE2Z

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for UBE2Z Gene

Disorders for UBE2Z Gene

MalaCards: The human disease database

(1) MalaCards diseases for UBE2Z Gene - From: DISEASES

Disorder Aliases PubMed IDs
diabetes mellitus, insulin-dependent, 19
  • iddm19
- elite association - COSMIC cancer census association via MalaCards
Search UBE2Z in MalaCards View complete list of genes associated with diseases

Additional Disease Information for UBE2Z

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with UBE2Z: view

No data available for UniProtKB/Swiss-Prot and Genatlas for UBE2Z Gene

Publications for UBE2Z Gene

  1. Dual E1 activation systems for ubiquitin differentially regulate E2 enzyme charging. (PMID: 17597759) Jin J … Harper JW (Nature 2007) 2 3 4 54
  2. Cloning and characterization of a gene encoding the human putative ubiquitin conjugating enzyme E2Z (UBE2Z). (PMID: 17160626) Gu X … Mao Y (Molecular biology reports 2007) 3 4 23 54
  3. Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease. (PMID: 21378990) Schunkert H … Samani NJ (Nature genetics 2011) 3 41 54
  4. Identification of novel regulators of apoptosis using a high-throughput cell-based screen. (PMID: 17464193) Park KM … Kim SJ (Molecules and cells 2007) 3 4 54
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 54

Products for UBE2Z Gene