Aliases for UBE2E2 Gene

Aliases for UBE2E2 Gene

  • Ubiquitin Conjugating Enzyme E2 E2 2 3 5
  • Ubiquitin-Conjugating Enzyme E2E 2 (Homologous To Yeast UBC4/5) 2 3
  • Ubiquitin-Conjugating Enzyme E2E 2 (UBC4/5 Homolog, Yeast) 2 3
  • Ubiquitin-Conjugating Enzyme E2 E2 3 4
  • E2 Ubiquitin-Conjugating Enzyme E2 3 4
  • Ubiquitin Carrier Protein E2 3 4
  • Ubiquitin-Protein Ligase E2 3 4
  • UBCH8 3 4
  • Ubiquitin Conjugating Enzyme E2E 2 3
  • Ubiquitin-Conjugating Enzyme E2E 2 2
  • EC 6.3.2.19 52
  • EC 2.3.2.23 4
  • UbcH8 4

External Ids for UBE2E2 Gene

Previous GeneCards Identifiers for UBE2E2 Gene

  • GC03U990078
  • GC03P023220

Summaries for UBE2E2 Gene

GeneCards Summary for UBE2E2 Gene

UBE2E2 (Ubiquitin Conjugating Enzyme E2 E2) is a Protein Coding gene. Diseases associated with UBE2E2 include Parkinson Disease, Late-Onset. Among its related pathways are Class I MHC mediated antigen processing and presentation and Innate Immune System. Gene Ontology (GO) annotations related to this gene include ligase activity and acid-amino acid ligase activity. An important paralog of this gene is UBE2E3.

UniProtKB/Swiss-Prot Summary for UBE2E2 Gene

  • Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.

Gene Wiki entry for UBE2E2 Gene

Additional gene information for UBE2E2 Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for UBE2E2 Gene

Genomics for UBE2E2 Gene

GeneHancer (GH) Regulatory Elements for UBE2E2 Gene

Promoters and enhancers for UBE2E2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH03J023202 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE CraniofacialAtlas 507 +0.6 594 3.2 HNRNPK SIN3A PHF8 ZIC2 POLR2A ZBTB10 ZBTB26 SAP30 MXI1 PCBP1 UBE2E2 UBE2E2-AS1 HMGB1P5 piR-39341-228
GH03J023113 Enhancer 1.1 FANTOM5 Ensembl ENCODE 26.9 -89.1 -89105 5 ZNF217 ZIC2 EP300 ATF2 CTBP1 ZNF341 OSR2 MYNN ZBTB17 CEBPG UBE2E2 RPL24P7 piR-58308-196
GH03J023159 Enhancer 1.2 FANTOM5 Ensembl ENCODE 17.9 -41.5 -41506 4.2 FOS EP300 JUND RELA MEF2C BCL11A NR2F2 FOXA2 ZNF316 ZNF384 UBE2E2 UBE2E2-AS1 lnc-NKIRAS1-6 RPL24P7
GH03J023242 Enhancer 0.6 Ensembl 16.5 +37.4 37394 4.8 ZBTB17 GATA3 FOS CEBPB RCOR1 PRDM6 ZNF664 ZNF398 PRDM4 HLF UBE2E2-AS1 UBE2E2 piR-39341-228
GH03J023164 Enhancer 0.6 FANTOM5 Ensembl 19 -36.8 -36807 4 ZNF341 FOS UBE2E2 UBE2E2-AS1 lnc-NKIRAS1-6 RPL24P7
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around UBE2E2 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for UBE2E2

Top Transcription factor binding sites by QIAGEN in the UBE2E2 gene promoter:
  • aMEF-2
  • FOXO4
  • GATA-6
  • Lhx3a
  • LHX3b
  • MEF-2A
  • PPAR-gamma1
  • PPAR-gamma2
  • SREBP-1a
  • STAT1

Genomic Locations for UBE2E2 Gene

Genomic Locations for UBE2E2 Gene
chr3:23,203,007-23,591,794
(GRCh38/hg38)
Size:
388,788 bases
Orientation:
Plus strand
chr3:23,244,511-23,633,284
(GRCh37/hg19)
Size:
388,774 bases
Orientation:
Plus strand

Genomic View for UBE2E2 Gene

Genes around UBE2E2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UBE2E2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UBE2E2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UBE2E2 Gene

Proteins for UBE2E2 Gene

  • Protein details for UBE2E2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q96LR5-UB2E2_HUMAN
    Recommended name:
    Ubiquitin-conjugating enzyme E2 E2
    Protein Accession:
    Q96LR5

    Protein attributes for UBE2E2 Gene

    Size:
    201 amino acids
    Molecular mass:
    22255 Da
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for UBE2E2 Gene

neXtProt entry for UBE2E2 Gene

Selected DME Specific Peptides for UBE2E2 Gene

Q96LR5:
  • STILGPPGSVYEGGVFFLDI
  • YPFKPPK
  • SKVLLSICSLLTD
  • TNRAEHDR
  • ICLDILK
  • ITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVF

Post-translational modifications for UBE2E2 Gene

Domains & Families for UBE2E2 Gene

Gene Families for UBE2E2 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for UBE2E2 Gene

Blocks:
  • Ubiquitin-conjugating enzymes
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for UBE2E2 Gene

GenScript: Design optimal peptide antigens:
  • Ubiquitin-protein ligase E2 (UB2E2_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q96LR5

UniProtKB/Swiss-Prot:

UB2E2_HUMAN :
  • Belongs to the ubiquitin-conjugating enzyme family.
Family:
  • Belongs to the ubiquitin-conjugating enzyme family.
genes like me logo Genes that share domains with UBE2E2: view

Function for UBE2E2 Gene

Molecular function for UBE2E2 Gene

UniProtKB/Swiss-Prot Function:
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.; EC=2.3.2.23; Evidence=. ;.
GENATLAS Biochemistry:
ubiquitin conjugating enzyme E2E2,homologous to yeast UBC4/5,ubiquitously expressed, involved in selective protein degradation

Enzyme Numbers (IUBMB) for UBE2E2 Gene

Phenotypes From GWAS Catalog for UBE2E2 Gene

Gene Ontology (GO) - Molecular Function for UBE2E2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity IDA 20061386
GO:0005515 protein binding IPI 17460044
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
GO:0042296 ISG15 transferase activity IDA 16428300
genes like me logo Genes that share ontologies with UBE2E2: view
genes like me logo Genes that share phenotypes with UBE2E2: view

Animal Models for UBE2E2 Gene

MGI Knock Outs for UBE2E2:
  • Ube2e2 Ube2e2<tm1b(KOMP)Wtsi>

Animal Model Products

CRISPR Products

miRNA for UBE2E2 Gene

miRTarBase miRNAs that target UBE2E2

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for UBE2E2 Gene

Localization for UBE2E2 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UBE2E2 gene
Compartment Confidence
nucleus 3
cytosol 2
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

No data available for Subcellular locations from UniProtKB/Swiss-Prot and Gene Ontology (GO) - Cellular Components for UBE2E2 Gene

Pathways & Interactions for UBE2E2 Gene

genes like me logo Genes that share pathways with UBE2E2: view

Pathways by source for UBE2E2 Gene

UniProtKB/Swiss-Prot Q96LR5-UB2E2_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for UBE2E2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006974 cellular response to DNA damage stimulus IMP 21628527
GO:0016567 protein ubiquitination IEA --
GO:0032020 ISG15-protein conjugation IDA 16428300
GO:0070534 protein K63-linked ubiquitination IDA 20061386
GO:0070936 protein K48-linked ubiquitination IDA,IBA 20061386
genes like me logo Genes that share ontologies with UBE2E2: view

No data available for SIGNOR curated interactions for UBE2E2 Gene

Drugs & Compounds for UBE2E2 Gene

(3) Drugs for UBE2E2 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for UBE2E2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8
genes like me logo Genes that share compounds with UBE2E2: view

Transcripts for UBE2E2 Gene

mRNA/cDNA for UBE2E2 Gene

5 REFSEQ mRNAs :
7 NCBI additional mRNA sequence :
7 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for UBE2E2 Gene

No ASD Table

Relevant External Links for UBE2E2 Gene

GeneLoc Exon Structure for
UBE2E2

Expression for UBE2E2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for UBE2E2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for UBE2E2 Gene

This gene is overexpressed in Testis (12.2), Uterus (10.0), Pancreatic juice (8.7), and Ovary (6.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for UBE2E2 Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for UBE2E2

SOURCE GeneReport for Unigene cluster for UBE2E2 Gene:

Hs.475688

Evidence on tissue expression from TISSUES for UBE2E2 Gene

  • Nervous system(4.8)
  • Liver(4.2)
genes like me logo Genes that share expression patterns with UBE2E2: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2E2 Gene

Orthologs for UBE2E2 Gene

This gene was present in the common ancestor of animals.

Orthologs for UBE2E2 Gene

Organism Taxonomy Gene Similarity Type Details
oppossum
(Monodelphis domestica)
Mammalia UBE2E2 31
  • 100 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia UBE2E2 31
  • 100 (a)
OneToOne
chimpanzee
(Pan troglodytes)
Mammalia UBE2E2 30
  • 99.83 (n)
dog
(Canis familiaris)
Mammalia UBE2E2 31 30
  • 97.01 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Ube2e2 17 31 30
  • 91.87 (n)
cow
(Bos Taurus)
Mammalia UBE2E2 31 30
  • 91.87 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Ube2e2 30
  • 91.49 (n)
chicken
(Gallus gallus)
Aves UBE2E2 30
  • 87.86 (n)
lizard
(Anolis carolinensis)
Reptilia UBE2E2 31
  • 92 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ube2e2 30
  • 82.59 (n)
zebrafish
(Danio rerio)
Actinopterygii ube2e1 31
  • 82 (a)
ManyToMany
ube2e2 30
  • 79.6 (n)
fruit fly
(Drosophila melanogaster)
Insecta UbcD2 31 30
  • 69.34 (n)
ManyToMany
CG5440 31
  • 65 (a)
ManyToMany
CG2574 31
  • 38 (a)
ManyToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP007952 30
  • 65.45 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.6406 31
  • 70 (a)
OneToMany
Species where no ortholog for UBE2E2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for UBE2E2 Gene

ENSEMBL:
Gene Tree for UBE2E2 (if available)
TreeFam:
Gene Tree for UBE2E2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for UBE2E2: view image

Paralogs for UBE2E2 Gene

(23) SIMAP similar genes for UBE2E2 Gene using alignment to 5 proteins:

  • UB2E2_HUMAN
  • C9J180_HUMAN
  • F8W8F0_HUMAN
  • F8WF15_HUMAN
  • L8E973_HUMAN
genes like me logo Genes that share paralogs with UBE2E2: view

Variants for UBE2E2 Gene

Additional dbSNP identifiers (rs#s) for UBE2E2 Gene

Structural Variations from Database of Genomic Variants (DGV) for UBE2E2 Gene

Variant ID Type Subtype PubMed ID
dgv4702n100 CNV loss 25217958
esv25457 CNV loss 19812545
esv2669216 CNV deletion 23128226
esv2674431 CNV deletion 23128226
esv2725037 CNV deletion 23290073
esv3305981 CNV mobile element insertion 20981092
esv3325176 CNV insertion 20981092
esv3407384 CNV insertion 20981092
esv3446183 CNV insertion 20981092
esv3568647 CNV loss 25503493
esv3595562 CNV loss 21293372
esv3595563 CNV loss 21293372
nsv1002823 CNV loss 25217958
nsv1004417 CNV gain 25217958
nsv1005186 CNV gain 25217958
nsv1007373 CNV gain 25217958
nsv1109501 CNV deletion 24896259
nsv236860 CNV deletion 16902084
nsv3731 CNV insertion 18451855
nsv460479 CNV gain 19166990
nsv475797 CNV novel sequence insertion 20440878
nsv478001 CNV novel sequence insertion 20440878
nsv526739 CNV loss 19592680
nsv589947 CNV gain 21841781
nsv589948 CNV loss 21841781
nsv589949 CNV gain 21841781
nsv834636 CNV gain+loss 17160897
nsv955618 CNV deletion 24416366

Variation tolerance for UBE2E2 Gene

Residual Variation Intolerance Score: 35.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.05; 1.07% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for UBE2E2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
UBE2E2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for UBE2E2 Gene

Disorders for UBE2E2 Gene

MalaCards: The human disease database

(1) MalaCards diseases for UBE2E2 Gene - From: DISEASES and Novoseek

Disorder Aliases PubMed IDs
parkinson disease, late-onset
  • pd
- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for UBE2E2

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with UBE2E2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for UBE2E2 Gene

Publications for UBE2E2 Gene

  1. cDNA cloning, characterization, and chromosome mapping of UBE2E2 encoding a human ubiquitin-conjugating E2 enzyme. (PMID: 9371400) Kimura M … Okano Y (Cytogenetics and cell genetics 1997) 2 3 4 23 54
  2. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41 54
  3. A genome-wide association study in the Japanese population identifies susceptibility loci for type 2 diabetes at UBE2E2 and C2CD4A-C2CD4B. (PMID: 20818381) Yamauchi T … Kadowaki T (Nature genetics 2010) 3 41 54
  4. The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. (PMID: 20061386) David Y … Navon A (The Journal of biological chemistry 2010) 3 4 54
  5. Identification and characterization of a novel endogenous murine parkin mutation. (PMID: 20089136) Ramsey CP … Giasson BI (Journal of neurochemistry 2010) 3 23 54

Products for UBE2E2 Gene

Sources for UBE2E2 Gene