The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enz... See more...

Aliases for UBE2E1 Gene

Aliases for UBE2E1 Gene

  • Ubiquitin Conjugating Enzyme E2 E1 2 3 5
  • Ubiquitin-Conjugating Enzyme E2E 1 (Homologous To Yeast UBC4/5) 2 3
  • Ubiquitin-Conjugating Enzyme E2E 1 (UBC4/5 Homolog, Yeast) 2 3
  • (E3-Independent) E2 Ubiquitin-Conjugating Enzyme E1 3 4
  • Ubiquitin-Conjugating Enzyme E2 E1 3 4
  • E2 Ubiquitin-Conjugating Enzyme E1 3 4
  • Ubiquitin Carrier Protein E1 3 4
  • Ubiquitin-Protein Ligase E1 3 4
  • UBCH6 3 4
  • UbcH6 2 4
  • Ubiquitin-Conjugating Enzyme E2E 1 2
  • Ubiquitin Conjugating Enzyme E2E 1 3
  • EC 6.3.2.19 51
  • EC 2.3.2.23 4
  • EC 2.3.2.24 4
  • UBE2E1 5

External Ids for UBE2E1 Gene

Previous GeneCards Identifiers for UBE2E1 Gene

  • GC03M023441
  • GC03P023529
  • GC03P023697
  • GC03P023822
  • GC03P023793
  • GC03P023847

Summaries for UBE2E1 Gene

Entrez Gene Summary for UBE2E1 Gene

  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

GeneCards Summary for UBE2E1 Gene

UBE2E1 (Ubiquitin Conjugating Enzyme E2 E1) is a Protein Coding gene. Diseases associated with UBE2E1 include Spinocerebellar Ataxia 1. Among its related pathways are Photodynamic therapy-induced unfolded protein response and Regulation of activated PAK-2p34 by proteasome mediated degradation. Gene Ontology (GO) annotations related to this gene include ligase activity and acid-amino acid ligase activity. An important paralog of this gene is UBE2E3.

UniProtKB/Swiss-Prot Summary for UBE2E1 Gene

  • Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination.

Gene Wiki entry for UBE2E1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for UBE2E1 Gene

Genomics for UBE2E1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for UBE2E1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH03J023803 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas 600.7 +1.9 1915 9.1 HNRNPL GATAD2A CTCF PRDM10 LEF1 IKZF1 ZNF692 POLR2A BACH1 JUND UBE2E1 UBE2E1-AS1 RPL15 NKIRAS1 NR1D2 RF00017-3943
GH03J023738 Enhancer 1.3 FANTOM5 Ensembl ENCODE 14.9 -65.6 -65555 4.4 PRDM10 ZNF629 IKZF1 ZNF692 BACH1 JUND PRDM1 PATZ1 REST ZNF501 lnc-UBE2E1-2 UBE2E1 UBE2E1-AS1 NR1D2 lnc-UBE2E1-1 UBE2E2
GH03J023818 Enhancer 1.1 Ensembl ENCODE 12.3 +22.2 22246 21.2 SP1 CTCF ZNF629 IKZF1 BACH1 STAT3 JUND PRDM1 RELA RAD21 UBE2E1 UBE2E1-AS1 RPL15 NKIRAS1 NR1D2 RF00017-3943 piR-38352-369
GH03J023644 Enhancer 1.2 Ensembl ENCODE dbSUPER 10.7 -158.1 -158128 7.3 CEBPG CREB1 PRDM10 ZNF629 ZNF692 CTCF ZNF600 ATF7 SCRT2 EED LOC105376993 RNU6-922P UBE2E1 UBE2E1-AS1 HSALNG0024674 UBE2E2
GH03J023862 Enhancer 1.1 Ensembl ENCODE CraniofacialAtlas 11.1 +59.4 59446 6.4 SP1 CTCF PRDM1 RAD21 ZNF600 ZBTB20 DPF2 RUNX3 ESR1 BCLAF1 hsa-miR-5095-338 RPL15 NKIRAS1 UBE2E1 UBE2E1-AS1 NR1D2 piR-54764-446
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around UBE2E1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for UBE2E1

Top Transcription factor binding sites by QIAGEN in the UBE2E1 gene promoter:
  • FOXD1
  • FOXL1
  • Pax-2
  • Pax-2a
  • POU2F1
  • POU2F1a
  • POU3F2 (N-Oct-5b)
  • PPAR-gamma1
  • PPAR-gamma2
  • STAT1

Genomic Locations for UBE2E1 Gene

Genomic Locations for UBE2E1 Gene
chr3:23,805,955-23,891,640
(GRCh38/hg38)
Size:
85,686 bases
Orientation:
Plus strand
chr3:23,847,384-23,933,131
(GRCh37/hg19)
Size:
85,748 bases
Orientation:
Plus strand

Genomic View for UBE2E1 Gene

Genes around UBE2E1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UBE2E1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UBE2E1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UBE2E1 Gene

Proteins for UBE2E1 Gene

  • Protein details for UBE2E1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P51965-UB2E1_HUMAN
    Recommended name:
    Ubiquitin-conjugating enzyme E2 E1
    Protein Accession:
    P51965
    Secondary Accessions:
    • B2RBX4
    • C9J8K2
    • K4DI90

    Protein attributes for UBE2E1 Gene

    Size:
    193 amino acids
    Molecular mass:
    21404 Da
    Quaternary structure:
    • Interacts with RNF14.

    Three dimensional structures from OCA and Proteopedia for UBE2E1 Gene

    Alternative splice isoforms for UBE2E1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for UBE2E1 Gene

Selected DME Specific Peptides for UBE2E1 Gene

P51965:
  • STILGPPGSVYEGGVFFLDI
  • YPFKPPK
  • SKVLLSICSLLTD
  • TNRAEHDR
  • ICLDILK
  • ITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVF

Post-translational modifications for UBE2E1 Gene

Domains & Families for UBE2E1 Gene

Gene Families for UBE2E1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for UBE2E1 Gene

InterPro:
Blocks:
  • Ubiquitin-conjugating enzymes
ProtoNet:

Suggested Antigen Peptide Sequences for UBE2E1 Gene

GenScript: Design optimal peptide antigens:
  • Ubiquitin-protein ligase E1 (UB2E1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P51965

UniProtKB/Swiss-Prot:

UB2E1_HUMAN :
  • Belongs to the ubiquitin-conjugating enzyme family.
Family:
  • Belongs to the ubiquitin-conjugating enzyme family.
genes like me logo Genes that share domains with UBE2E1: view

Function for UBE2E1 Gene

Molecular function for UBE2E1 Gene

UniProtKB/Swiss-Prot Function:
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.; EC=2.3.2.23; Evidence={ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133, ECO:0000269|PubMed:20061386};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.24; Evidence={ECO:0000269|PubMed:17588522};.

Enzyme Numbers (IUBMB) for UBE2E1 Gene

Phenotypes From GWAS Catalog for UBE2E1 Gene

Gene Ontology (GO) - Molecular Function for UBE2E1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004842 ubiquitin-protein transferase activity TAS,IDA 16307923
GO:0005515 protein binding IPI 16307923
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with UBE2E1: view
genes like me logo Genes that share phenotypes with UBE2E1: view

Animal Model Products

CRISPR Products

miRNA for UBE2E1 Gene

miRTarBase miRNAs that target UBE2E1

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for UBE2E1

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for UBE2E1 Gene

Localization for UBE2E1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for UBE2E1 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UBE2E1 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for UBE2E1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000151 ubiquitin ligase complex IDA 15247280
GO:0005634 nucleus IEA,IDA 18845142
GO:0005654 nucleoplasm TAS --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with UBE2E1: view

Pathways & Interactions for UBE2E1 Gene

PathCards logo

SuperPathways for UBE2E1 Gene

SuperPathway Contained pathways
1 Regulation of activated PAK-2p34 by proteasome mediated degradation
2 APC-Cdc20 mediated degradation of Nek2A
3 Protein ubiquitination
4 Class I MHC mediated antigen processing and presentation
5 Cell Cycle, Mitotic
.60
genes like me logo Genes that share pathways with UBE2E1: view

Pathways by source for UBE2E1 Gene

1 R&D Systems pathway for UBE2E1 Gene
2 Qiagen pathways for UBE2E1 Gene
  • Remodeling of Adherens Junctions
  • Ubiquitin-Proteasome Dependent Proteolysis
1 GeneTex pathway for UBE2E1 Gene

UniProtKB/Swiss-Prot P51965-UB2E1_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for UBE2E1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination IDA 15247280
GO:0006511 ubiquitin-dependent protein catabolic process TAS --
GO:0010390 histone monoubiquitination IDA 16307923
GO:0016567 protein ubiquitination IDA,TAS --
GO:0031145 anaphase-promoting complex-dependent catabolic process TAS --
genes like me logo Genes that share ontologies with UBE2E1: view

No data available for SIGNOR curated interactions for UBE2E1 Gene

Drugs & Compounds for UBE2E1 Gene

(4) Drugs for UBE2E1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation 0

(1) Additional Compounds for UBE2E1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8
genes like me logo Genes that share compounds with UBE2E1: view

Transcripts for UBE2E1 Gene

mRNA/cDNA for UBE2E1 Gene

3 REFSEQ mRNAs :
8 NCBI additional mRNA sequence :
11 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for UBE2E1

Alternative Splicing Database (ASD) splice patterns (SP) for UBE2E1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9a · 9b · 9c · 9d · 9e
SP1: - - - - - -
SP2: - - - - -
SP3: - - - -
SP4: - - -
SP5: - - - - - - -
SP6: - - - - - - -
SP7: - - - - -
SP8: - - -
SP9: - - -

Relevant External Links for UBE2E1 Gene

GeneLoc Exon Structure for
UBE2E1

Expression for UBE2E1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for UBE2E1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for UBE2E1 Gene

This gene is overexpressed in Breast (45.4) and Peripheral blood mononuclear cells (10.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for UBE2E1 Gene



Protein tissue co-expression partners for UBE2E1 Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for UBE2E1

SOURCE GeneReport for Unigene cluster for UBE2E1 Gene:

Hs.164853

Evidence on tissue expression from TISSUES for UBE2E1 Gene

  • Nervous system(4.7)
  • Intestine(4.5)
  • Kidney(2.6)
  • Muscle(2.5)
  • Skin(2.5)
  • Lymph node(2.4)
  • Heart(2.3)
  • Spleen(2.3)
  • Blood(2.2)
  • Lung(2.2)
  • Liver(2.1)
  • Eye(2)
genes like me logo Genes that share expression patterns with UBE2E1: view

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2E1 Gene

Orthologs for UBE2E1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for UBE2E1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia UBE2E1 30 31
  • 100 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia UBE2E1 30 31
  • 97.06 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia UBE2E1 30
  • 92.75 (n)
Rat
(Rattus norvegicus)
Mammalia Ube2e1 30
  • 91.54 (n)
Mouse
(Mus musculus)
Mammalia Ube2e1 30 17 31
  • 91.02 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia UBE2E1 31
  • 91 (a)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia UBE2E1 31
  • 84 (a)
OneToOne
Chicken
(Gallus gallus)
Aves UBE2E1 30 31
  • 87.05 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia UBE2E1 31
  • 99 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia ube2e1 30
  • 83.13 (n)
MGC75971 30
Zebrafish
(Danio rerio)
Actinopterygii ube2e2 31
  • 80 (a)
ManyToMany
ube2e1 30
  • 79.5 (n)
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.4084 30
Fruit Fly
(Drosophila melanogaster)
Insecta UbcD2 31 32
  • 64 (a)
ManyToMany
CG5440 31 32
  • 64 (a)
ManyToMany
CG10862 32
  • 51 (a)
CG2574 31 32
  • 37 (a)
ManyToMany
Soybean
(Glycine max)
eudicotyledons Gma.1978 30
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.6406 31
  • 71 (a)
OneToMany
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.6467 30
Species where no ortholog for UBE2E1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)
  • Worm (Caenorhabditis elegans)

Evolution for UBE2E1 Gene

ENSEMBL:
Gene Tree for UBE2E1 (if available)
TreeFam:
Gene Tree for UBE2E1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for UBE2E1: view image

Paralogs for UBE2E1 Gene

(24) SIMAP similar genes for UBE2E1 Gene using alignment to 4 proteins:

  • UB2E1_HUMAN
  • B7Z306_HUMAN
  • C9J2P0_HUMAN
  • H7C061_HUMAN
genes like me logo Genes that share paralogs with UBE2E1: view

Variants for UBE2E1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for UBE2E1 Gene

SNP ID Clinical significance and condition Chr 03 pos Variation AA Info Type
779087 Benign: not provided 23,889,189(+) T/C SYNONYMOUS_VARIANT
781706 Benign: not provided 23,887,582(+) C/T SYNONYMOUS_VARIANT
rs36060625 - p.Glu25Asp

Additional dbSNP identifiers (rs#s) for UBE2E1 Gene

Structural Variations from Database of Genomic Variants (DGV) for UBE2E1 Gene

Variant ID Type Subtype PubMed ID
esv3378355 CNV insertion 20981092
esv3561606 CNV deletion 23714750
esv3575556 CNV gain 25503493
esv3595568 CNV loss 21293372
nsv1005186 CNV gain 25217958
nsv834637 CNV loss 17160897
nsv954452 CNV duplication 24416366

Variation tolerance for UBE2E1 Gene

Residual Variation Intolerance Score: 42.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.39; 54.17% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for UBE2E1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
UBE2E1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UBE2E1 Gene

Disorders for UBE2E1 Gene

MalaCards: The human disease database

(1) MalaCards diseases for UBE2E1 Gene - From: DISEASES

Disorder Aliases PubMed IDs
spinocerebellar ataxia 1
  • sca1
- elite association - COSMIC cancer census association via MalaCards
genes like me logo Genes that share disorders with UBE2E1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for UBE2E1 Gene

Publications for UBE2E1 Gene

  1. Cloning of human ubiquitin-conjugating enzymes UbcH6 and UbcH7 (E2-F1) and characterization of their interaction with E6-AP and RSP5. (PMID: 8576257) Nuber U … Scheffner M (The Journal of biological chemistry 1996) 2 3 4
  2. The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. (PMID: 20061386) David Y … Navon A (The Journal of biological chemistry 2010) 3 4
  3. The autoantigen Ro52 is an E3 ligase resident in the cytoplasm but enters the nucleus upon cellular exposure to nitric oxide. (PMID: 18845142) Espinosa A … Wahren-Herlenius M (Experimental cell research 2008) 3 4
  4. E3-independent monoubiquitination of ubiquitin-binding proteins. (PMID: 17588522) Hoeller D … Dikic I (Molecular cell 2007) 3 4
  5. E3 ubiquitin ligase activity of the trifunctional ARD1 (ADP-ribosylation factor domain protein 1). (PMID: 15684077) Vichi A … Vaughan M (Proceedings of the National Academy of Sciences of the United States of America 2005) 3 23

Products for UBE2E1 Gene

Sources for UBE2E1 Gene