Free for academic non-profit institutions. Other users need a Commercial license

Aliases for UBE2C Gene

Aliases for UBE2C Gene

  • Ubiquitin Conjugating Enzyme E2 C 2 3 5
  • (E3-Independent) E2 Ubiquitin-Conjugating Enzyme C 3 4
  • E2 Ubiquitin-Conjugating Enzyme C 3 4
  • Ubiquitin-Protein Ligase C 3 4
  • UBCH10 3 4
  • Mitotic-Specific Ubiquitin-Conjugating Enzyme 3
  • Cyclin-Selective Ubiquitin Carrier Protein 3
  • Ubiquitin-Conjugating Enzyme E2 C 3
  • Ubiquitin-Conjugating Enzyme E2C 2
  • Ubiquitin Conjugating Enzyme E2C 3
  • Ubiquitin Carrier Protein C 4
  • EC 6.3.2.19 56
  • EC 2.3.2.23 4
  • EC 2.3.2.24 4
  • DJ447F3.2 3

External Ids for UBE2C Gene

Previous GeneCards Identifiers for UBE2C Gene

  • GC20P044169
  • GC20P045079
  • GC20P045126
  • GC20P043874
  • GC20P044442
  • GC20P041183

Summaries for UBE2C Gene

Entrez Gene Summary for UBE2C Gene

  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013]

GeneCards Summary for UBE2C Gene

UBE2C (Ubiquitin Conjugating Enzyme E2 C) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Innate Immune System. Gene Ontology (GO) annotations related to this gene include ligase activity and ubiquitin protein ligase binding. An important paralog of this gene is UBE2U.

UniProtKB/Swiss-Prot for UBE2C Gene

  • Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating Lys-11-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Gene Wiki entry for UBE2C Gene

Additional gene information for UBE2C Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for UBE2C Gene

Genomics for UBE2C Gene

GeneHancer (GH) Regulatory Elements for UBE2C Gene

Promoters and enhancers for UBE2C Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH20I045811 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE 550.8 +0.1 67 2.5 HDGF PKNOX1 ARID4B SIN3A DMAP1 ZNF48 GLIS2 ELK1 ZNF207 FOS UBE2C WFDC3 NCOA5 TP53RK ZNF335 PCIF1 SPATA25 ENSG00000271984 CD40 DNTTIP1
GH20I045814 Promoter 0.7 Ensembl 550.8 +1.6 1625 0.4 ZNF189 PRDM1 UBE2C WFDC3 DNTTIP1 WFDC13 SNX21
GH20I045933 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 11.1 +123.8 123754 6.3 CLOCK MLX ZFP64 FEZF1 DMAP1 YY1 SLC30A9 ZNF213 E2F8 ZNF143 PCIF1 SNX21 NCOA5 TP53RK SPATA25 ZNF335 PLTP SLC35C2 WFDC3 ENSG00000271984
GH20I045909 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE dbSUPER 10.4 +98.4 98381 3.7 HDGF PKNOX1 MLX ZFP64 ARID4B SIN3A DMAP1 YY1 POLR2B ZNF766 PLTP SLC12A5-AS1 ACOT8 ZSWIM3 TNNC2 SNX21 UBE2C WFDC3 DNTTIP1 SLC12A5
GH20I045917 Enhancer 1.3 Ensembl ENCODE dbSUPER 10.9 +106.7 106651 4 ELF3 FOXA2 ARNT ARID4B THRB ZNF48 ZSCAN9 RARA THAP11 EGR2 WFDC3 CTSA NEURL2 SPATA25 PLTP ACOT8 ZSWIM3 TNNC2 SNX21 UBE2C
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around UBE2C on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the UBE2C gene promoter:

Genomic Locations for UBE2C Gene

Genomic Locations for UBE2C Gene
chr20:45,812,576-45,816,957
(GRCh38/hg38)
Size:
4,382 bases
Orientation:
Plus strand
chr20:44,441,215-44,445,596
(GRCh37/hg19)

Genomic View for UBE2C Gene

Genes around UBE2C on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UBE2C Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UBE2C Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UBE2C Gene

Proteins for UBE2C Gene

  • Protein details for UBE2C Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O00762-UBE2C_HUMAN
    Recommended name:
    Ubiquitin-conjugating enzyme E2 C
    Protein Accession:
    O00762
    Secondary Accessions:
    • A6NP33
    • E1P5N7
    • G3XAB7

    Protein attributes for UBE2C Gene

    Size:
    179 amino acids
    Molecular mass:
    19652 Da
    Quaternary structure:
    • Component of the APC/C complex, composed of at least 14 distinct subunits that assemble into a complex of at least 19 chains with a combined molecular mass of around 1.2 MDa. Within this complex, directly interacts with ANAPC2.

    Three dimensional structures from OCA and Proteopedia for UBE2C Gene

    Alternative splice isoforms for UBE2C Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for UBE2C Gene

Selected DME Specific Peptides for UBE2C Gene

O00762:
  • VGKRLQQELMTLMMSGDKGISAFPESDNLFKW
  • QSLLGEPN
  • ICLDILK
  • GTVYEDLRYKLSLEFPSGYPYNAPTVKF

Post-translational modifications for UBE2C Gene

  • Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed.
  • Ubiquitination at isoforms=2, 380 and posLast=121121
  • Modification sites at PhosphoSitePlus

Domains & Families for UBE2C Gene

Gene Families for UBE2C Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for UBE2C Gene

Graphical View of Domain Structure for InterPro Entry

O00762

UniProtKB/Swiss-Prot:

UBE2C_HUMAN :
  • Belongs to the ubiquitin-conjugating enzyme family.
Family:
  • Belongs to the ubiquitin-conjugating enzyme family.
genes like me logo Genes that share domains with UBE2C: view

Function for UBE2C Gene

Molecular function for UBE2C Gene

UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.
UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot Function:
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating Lys-11-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Enzyme Numbers (IUBMB) for UBE2C Gene

Phenotypes From GWAS Catalog for UBE2C Gene

Gene Ontology (GO) - Molecular Function for UBE2C Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004842 contributes_to ubiquitin-protein transferase activity IDA 18485873
GO:0005515 protein binding IPI 19822757
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with UBE2C: view
genes like me logo Genes that share phenotypes with UBE2C: view

Animal Models for UBE2C Gene

MGI Knock Outs for UBE2C:

Animal Model Products

  • Taconic Biosciences Mouse Models for UBE2C

Clone Products

  • Addgene plasmids for UBE2C

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for UBE2C Gene

Localization for UBE2C Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UBE2C gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 5
cytoskeleton 1
mitochondrion 1
peroxisome 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (4)
  • Plasma membrane (4)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for UBE2C Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000151 ubiquitin ligase complex IDA 15749827
GO:0005654 nucleoplasm TAS --
GO:0005680 anaphase-promoting complex IDA 18485873
GO:0005737 cytoplasm IBA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with UBE2C: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for UBE2C Gene

Pathways & Interactions for UBE2C Gene

SuperPathways for UBE2C Gene

SuperPathway Contained pathways
1 CDK-mediated phosphorylation and removal of Cdc6
2 APC-Cdc20 mediated degradation of Nek2A
3 Protein ubiquitination
4 Class I MHC mediated antigen processing and presentation
5 Cell Cycle, Mitotic
.60
genes like me logo Genes that share pathways with UBE2C: view

UniProtKB/Swiss-Prot O00762-UBE2C_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for UBE2C Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006511 ubiquitin-dependent protein catabolic process IDA 9122200
GO:0007049 cell cycle IEA --
GO:0010458 exit from mitosis IMP 19822757
GO:0010994 free ubiquitin chain polymerization IDA 19822757
GO:0016567 protein ubiquitination TAS --
genes like me logo Genes that share ontologies with UBE2C: view

No data available for SIGNOR curated interactions for UBE2C Gene

Drugs & Compounds for UBE2C Gene

(5) Drugs for UBE2C Gene - From: ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist 0
NSC697923 Pharma Inhibitor of E2 complex Ubc13-Uev1A,cell permeable and selective, Selective UBE2N inhibitor 0

(2) Additional Compounds for UBE2C Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8

(1) ApexBio Compounds for UBE2C Gene

Compound Action Cas Number
NSC697923 Inhibitor of E2 complex Ubc13-Uev1A,cell permeable and selective 343351-67-7
genes like me logo Genes that share compounds with UBE2C: view

Drug Products

Transcripts for UBE2C Gene

Unigene Clusters for UBE2C Gene

Ubiquitin-conjugating enzyme E2C:
Representative Sequences:

Clone Products

  • Addgene plasmids for UBE2C

Alternative Splicing Database (ASD) splice patterns (SP) for UBE2C Gene

ExUns: 1a · 1b ^ 2a · 2b ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6a · 6b
SP1: - - -
SP2: - - -
SP3: - - - -
SP4: - - - -
SP5: - - - -
SP6: -
SP7: - - - - -
SP8:

Relevant External Links for UBE2C Gene

GeneLoc Exon Structure for
UBE2C
ECgene alternative splicing isoforms for
UBE2C

Expression for UBE2C Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for UBE2C Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for UBE2C Gene

This gene is overexpressed in Esophagus - Mucosa (x5.0).

Protein differential expression in normal tissues from HIPED for UBE2C Gene

This gene is overexpressed in Bone (41.7) and Stomach (8.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for UBE2C Gene



Protein tissue co-expression partners for UBE2C Gene

NURSA nuclear receptor signaling pathways regulating expression of UBE2C Gene:

UBE2C

SOURCE GeneReport for Unigene cluster for UBE2C Gene:

Hs.93002
genes like me logo Genes that share expression patterns with UBE2C: view

No data available for mRNA Expression by UniProt/SwissProt , Evidence on tissue expression from TISSUES and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2C Gene

Orthologs for UBE2C Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for UBE2C Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia -- 34
  • 100 (a)
OneToMany
-- 34
  • 100 (a)
OneToMany
UBE2C 33
  • 99.44 (n)
dog
(Canis familiaris)
Mammalia UBE2C 33 34
  • 93.11 (n)
oppossum
(Monodelphis domestica)
Mammalia UBE2C 34
  • 93 (a)
OneToOne
cow
(Bos Taurus)
Mammalia UBE2C 33 34
  • 91.43 (n)
rat
(Rattus norvegicus)
Mammalia Ube2c 33
  • 89.76 (n)
mouse
(Mus musculus)
Mammalia Ube2c 33 16 34
  • 87.52 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia UBE2C 34
  • 70 (a)
OneToOne
chicken
(Gallus gallus)
Aves UBE2C 33 34
  • 78.41 (n)
tropical clawed frog
(Silurana tropicalis)
Amphibia ube2c 33
  • 72.47 (n)
zebrafish
(Danio rerio)
Actinopterygii ube2c 33 34
  • 68.44 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8806 33
fruit fly
(Drosophila melanogaster)
Insecta vihar 35
  • 66 (a)
vih 33 34
  • 65.5 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006238 33
  • 61.3 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes UBC11 33 34 36
  • 56.25 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons UBC19 33
  • 58.9 (n)
Alicante grape
(Vitis vinifera)
eudicotyledons Vvi.9379 33
rice
(Oryza sativa)
Liliopsida Os01g0273100 33
  • 64.2 (n)
Os.247 33
barley
(Hordeum vulgare)
Liliopsida Hv.2165 33
wheat
(Triticum aestivum)
Liliopsida Ta.3436 33
sea squirt
(Ciona savignyi)
Ascidiacea CSA.3903 34
  • 60 (a)
OneToOne
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes ubc11 33
  • 52.32 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5287 33
Species where no ortholog for UBE2C was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • lizard (Anolis carolinensis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • worm (Caenorhabditis elegans)

Evolution for UBE2C Gene

ENSEMBL:
Gene Tree for UBE2C (if available)
TreeFam:
Gene Tree for UBE2C (if available)

Paralogs for UBE2C Gene

Paralogs for UBE2C Gene

genes like me logo Genes that share paralogs with UBE2C: view

Variants for UBE2C Gene

Sequence variations from dbSNP and Humsavar for UBE2C Gene

SNP ID Clin Chr 20 pos Variation AA Info Type
rs1000133927 -- 45,813,221(+) G/A 5_prime_UTR_variant, intron_variant
rs1001117166 -- 45,811,909(+) A/C upstream_transcript_variant
rs1001280343 -- 45,810,823(+) G/A/C upstream_transcript_variant
rs1001371810 -- 45,812,501(+) G/T upstream_transcript_variant
rs1001764447 -- 45,816,344(+) A/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for UBE2C Gene

Variant ID Type Subtype PubMed ID
nsv586132 CNV loss 21841781
nsv833990 CNV loss 17160897
nsv965879 CNV duplication 23825009

Variation tolerance for UBE2C Gene

Residual Variation Intolerance Score: 40.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.85; 58.81% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for UBE2C Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
UBE2C

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UBE2C Gene

Disorders for UBE2C Gene

Additional Disease Information for UBE2C

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for UBE2C Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for UBE2C Gene

Publications for UBE2C Gene

  1. Dominant-negative cyclin-selective ubiquitin carrier protein E2-C/UbcH10 blocks cells in metaphase. (PMID: 9122200) Townsley FM … Ruderman JV (Proceedings of the National Academy of Sciences of the United States of America 1997) 2 3 4 22 58
  2. Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C. (PMID: 27259151) Brown NG … Schulman BA (Cell 2016) 3 4 58
  3. The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. (PMID: 20061386) David Y … Navon A (The Journal of biological chemistry 2010) 3 4 58
  4. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 44 58
  5. Knockdown of ubiquitin-conjugating enzyme E2C/UbcH10 expression by RNA interference inhibits glioma cell proliferation and enhances cell apoptosis in vitro. (PMID: 19657671) Jiang L … Lu Y (Journal of cancer research and clinical oncology 2010) 3 22 58

Products for UBE2C Gene

  • Addgene plasmids for UBE2C

Sources for UBE2C Gene

Content
Loading form....