Free for academic non-profit institutions. Other users need a Commercial license

Aliases for TRMU Gene

Aliases for TRMU Gene

  • TRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase 2 3 5
  • MTO2 Homolog 3 4
  • TRMT1 3 4
  • MTU1 3 4
  • Mitochondrial 5-Methylaminomethyl-2-Thiouridylate-Methyltransferase 3
  • TRNA (5-Methylaminomethyl-2-Thiouridylate)-Methyltransferase 2
  • Mitochondrial TRNA-Specific 2-Thiouridylase 1 3
  • Lung Cancer Associated LncRNA 3 3
  • EC 2.8.1.14 4
  • EC 2.8.1 56
  • LCAL3 3
  • MTO2 3
  • TRMT 3

External Ids for TRMU Gene

Previous HGNC Symbols for TRMU Gene

  • TRMT

Previous GeneCards Identifiers for TRMU Gene

  • GC22P045053
  • GC22P045109
  • GC22P046726
  • GC22P029675

Summaries for TRMU Gene

Entrez Gene Summary for TRMU Gene

  • This nuclear gene encodes a mitochondrial tRNA-modifying enzyme. The encoded protein catalyzes the 2-thiolation of uridine on the wobble positions of tRNA(Lys), tRNA(Glu), and tRNA(Gln), resulting in the formation of 5-taurinomethyl-2-thiouridine moieties. Mutations in this gene may cause transient infantile liver failure. Polymorphisms in this gene may also influence the severity of deafness caused by mitochondrial 12S ribosomal RNA mutations. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

GeneCards Summary for TRMU Gene

TRMU (TRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase) is a Protein Coding gene. Diseases associated with TRMU include Liver Failure, Infantile, Transient and Deafness, Aminoglycoside-Induced. Among its related pathways are Gene Expression and tRNA processing. Gene Ontology (GO) annotations related to this gene include methyltransferase activity and tRNA binding.

UniProtKB/Swiss-Prot for TRMU Gene

  • Catalyzes the 2-thiolation of uridine at the wobble position (U34) of mitochondrial tRNA(Lys), tRNA(Glu) and tRNA(Gln). Required for the formation of 5-taurinomethyl-2-thiouridine (tm5s2U) of mitochondrial tRNA(Lys), tRNA(Glu), and tRNA(Gln) at the wobble position. ATP is required to activate the C2 atom of the wobble base.

Gene Wiki entry for TRMU Gene

Additional gene information for TRMU Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TRMU Gene

Genomics for TRMU Gene

GeneHancer (GH) Regulatory Elements for TRMU Gene

Promoters and enhancers for TRMU Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH22I046334 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 567.5 +4.9 4934 2.9 PKNOX1 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1 E2F8 TRMU PKDREJ CDPF1 CELSR1 ENSG00000234869 LOC642648 PIR55573
GH22I046049 Promoter/Enhancer 2.8 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 71.8 -258.1 -258135 45.7 HDGF PKNOX1 FOXA2 SMAD1 ZFP64 SIN3A FEZF1 ZNF2 IRF4 YY1 LOC642648 PRR34 CDPF1 TRMU LINC00899 ATXN10 ENSG00000273243 ENSG00000273287 FAM118A TTC38
GH22I045978 Promoter/Enhancer 1.5 Ensembl ENCODE 54.1 -351.8 -351840 0.9 HDGF ZNF133 ARID4B SIN3A GLI4 ZNF2 ZNF48 GLIS2 ZNF143 KLF7 WNT7B TRMU CDPF1 FBLN1 ENSG00000273243 LINC00899 LOC642648 KIAA0930 NUP50 ATXN10
GH22I045979 Enhancer 0.9 ENCODE 51.7 -351.1 -351099 0.2 HDGF ZNF133 ZNF2 TCF12 ZNF280A ZNF121 ARID2 ZNF662 ZNF488 ZNF292 CDPF1 TRMU ENSG00000273243 LINC00899 PHF21B FBLN1 LOC642648 FAM118A KIAA0930 NUP50
GH22I046006 Promoter/Enhancer 2.2 FANTOM5 Ensembl ENCODE dbSUPER 20.3 -320.1 -320134 9.5 HDGF PKNOX1 FOXA2 ARID4B SIN3A DMAP1 ZNF2 YY1 POLR2B ZNF213 LINC00899 CDPF1 TRMU ENSG00000273243 LOC642648 PRR34 PRR34-AS1 MIRLET7BHG ENSG00000231010 NUP50
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around TRMU on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the TRMU gene promoter:

Genomic Locations for TRMU Gene

Genomic Locations for TRMU Gene
chr22:46,330,875-46,357,340
(GRCh38/hg38)
Size:
26,466 bases
Orientation:
Plus strand
chr22:46,726,772-46,753,237
(GRCh37/hg19)

Genomic View for TRMU Gene

Genes around TRMU on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TRMU Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TRMU Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TRMU Gene

Proteins for TRMU Gene

  • Protein details for TRMU Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O75648-MTU1_HUMAN
    Recommended name:
    Mitochondrial tRNA-specific 2-thiouridylase 1
    Protein Accession:
    O75648
    Secondary Accessions:
    • A8K3U7
    • Q05C99
    • Q5W9C8
    • Q66K31
    • Q6ICC3
    • Q9NWC1

    Protein attributes for TRMU Gene

    Size:
    421 amino acids
    Molecular mass:
    47745 Da
    Quaternary structure:
    No Data Available
    Miscellaneous:
    • During the reaction, ATP is used to activate the C2 atom of U34 by adenylation. After this, the persulfide sulfur on the catalytic cysteine is transferred to the C2 atom of the wobble base (U34) of mitochondrial tRNA(Lys), tRNA(Glu) and tRNA(Gln). The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards the activated C2 atom on U34. Subsequently, a transient disulfide bond is formed between the two active site cysteine residues (By similarity).

    Alternative splice isoforms for TRMU Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for TRMU Gene

Selected DME Specific Peptides for TRMU Gene

O75648:
  • GVFMKNW
  • ATGHYAR
  • CNKHIKF
  • HWIAEEPPA
  • GRTPNPDI
  • GQFAVFYKG
  • LVRDKMMECHFRFRHQMALVPCVLTLNQDG
  • EYEKGRTPNPD
  • IATGHYA
  • KDQTFFL
  • VSYVKEYW
  • LHHVLQK
  • LFRNRFEVRN

Post-translational modifications for TRMU Gene

No Post-translational modifications

Domains & Families for TRMU Gene

Gene Families for TRMU Gene

Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

O75648

UniProtKB/Swiss-Prot:

MTU1_HUMAN :
  • Belongs to the MnmA/TRMU family.
Family:
  • Belongs to the MnmA/TRMU family.
genes like me logo Genes that share domains with TRMU: view

Function for TRMU Gene

Molecular function for TRMU Gene

UniProtKB/Swiss-Prot CatalyticActivity:
A [protein]-S-sulfanyl-L-cysteine + 5-taurinomethyluridine(34) in tRNA + ATP + reduced acceptor = a [protein]-L-cysteine + 5-taurinomethyl-2-thiouridine(34) in tRNA + AMP + diphosphate + acceptor.
UniProtKB/Swiss-Prot Function:
Catalyzes the 2-thiolation of uridine at the wobble position (U34) of mitochondrial tRNA(Lys), tRNA(Glu) and tRNA(Gln). Required for the formation of 5-taurinomethyl-2-thiouridine (tm5s2U) of mitochondrial tRNA(Lys), tRNA(Glu), and tRNA(Gln) at the wobble position. ATP is required to activate the C2 atom of the wobble base.

Enzyme Numbers (IUBMB) for TRMU Gene

Phenotypes From GWAS Catalog for TRMU Gene

Gene Ontology (GO) - Molecular Function for TRMU Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000049 tRNA binding IEA --
GO:0000166 nucleotide binding IEA --
GO:0003723 RNA binding IEA --
GO:0005524 ATP binding IEA --
GO:0008168 methyltransferase activity IEA --
genes like me logo Genes that share ontologies with TRMU: view
genes like me logo Genes that share phenotypes with TRMU: view

Human Phenotype Ontology for TRMU Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for TRMU Gene

MGI Knock Outs for TRMU:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

No data available for Transcription Factor Targets and HOMER Transcription for TRMU Gene

Localization for TRMU Gene

Subcellular locations from UniProtKB/Swiss-Prot for TRMU Gene

Mitochondrion.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TRMU gene
Compartment Confidence
mitochondrion 5
nucleus 5
extracellular 2
peroxisome 1
endoplasmic reticulum 1
cytosol 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Mitochondria (3)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for TRMU Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005654 nucleoplasm IDA --
GO:0005739 mitochondrion IBA,ISS --
genes like me logo Genes that share ontologies with TRMU: view

Pathways & Interactions for TRMU Gene

genes like me logo Genes that share pathways with TRMU: view

Pathways by source for TRMU Gene

Gene Ontology (GO) - Biological Process for TRMU Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002143 tRNA wobble position uridine thiolation IBA --
GO:0008033 tRNA processing IEA --
GO:0032259 methylation IEA --
GO:0070903 mitochondrial tRNA thio-modification IBA --
genes like me logo Genes that share ontologies with TRMU: view

No data available for SIGNOR curated interactions for TRMU Gene

Drugs & Compounds for TRMU Gene

(1) Drugs for TRMU Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
s-adenosylhomocysteine Experimental Pharma 0

(1) Additional Compounds for TRMU Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
s-adenosylmethionine
  • (3S)-5'-[(3-amino-3-carboxypropyl)methylsulfonio]-5'-deoxyadenosine
  • 2-S-Adenosyl-L-methionine
  • 5'-Deoxyadenosine-5'-L-methionine disulfate ditosylate
  • 5'-Deoxyadenosine-5'-L-methionine disulphate ditosylate
  • Active methionine
29908-03-0
genes like me logo Genes that share compounds with TRMU: view

Transcripts for TRMU Gene

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for TRMU Gene

ExUns: 1a · 1b · 1c · 1d · 1e ^ 2a · 2b ^ 3a · 3b ^ 4 ^ 5a · 5b ^ 6a · 6b · 6c · 6d · 6e ^ 7a · 7b ^ 8a · 8b · 8c ^ 9a · 9b ^ 10 ^ 11a ·
SP1: - - - - - - - -
SP2: - - - - - - - - -
SP3: - - - - - - - -
SP4: - - - - - - - - - -
SP5: - - - - - -
SP6: - - - - - - - -
SP7: - - - - - -
SP8: - - - - - - -
SP9: -
SP10: - - - - -
SP11: - - -
SP12: - -
SP13:
SP14:
SP15: -
SP16:
SP17: - -

ExUns: 11b ^ 12a · 12b ^ 13a · 13b · 13c · 13d · 13e · 13f
SP1: -
SP2: -
SP3: - -
SP4: - -
SP5: -
SP6:
SP7:
SP8:
SP9: -
SP10:
SP11:
SP12:
SP13: -
SP14:
SP15:
SP16: -
SP17:

Relevant External Links for TRMU Gene

GeneLoc Exon Structure for
TRMU
ECgene alternative splicing isoforms for
TRMU

Expression for TRMU Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for TRMU Gene

Protein differential expression in normal tissues from HIPED for TRMU Gene

This gene is overexpressed in Lung (26.8) and Plasma (23.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TRMU Gene



NURSA nuclear receptor signaling pathways regulating expression of TRMU Gene:

TRMU

mRNA Expression by UniProt/SwissProt for TRMU Gene:

O75648-MTU1_HUMAN
Tissue specificity: Ubiquitous. Abundantly expressed in tissues with high metabolic rates including heart, liver, kidney, and brain.

Evidence on tissue expression from TISSUES for TRMU Gene

  • Lung(4.2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for TRMU Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • integumentary
  • nervous
  • respiratory
  • skeletal muscle
Regions:
Head and neck:
  • brain
  • cranial nerve
  • ear
  • eye
  • face
  • head
  • inner ear
  • middle ear
  • mouth
  • neck
  • outer ear
  • tongue
Thorax:
  • esophagus
  • heart
  • heart valve
  • lung
Abdomen:
  • liver
  • stomach
Limb:
  • forearm
General:
  • blood
  • coagulation system
  • peripheral nerve
  • peripheral nervous system
  • red blood cell
  • skin
genes like me logo Genes that share expression patterns with TRMU: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Protein tissue co-expression partners for TRMU Gene

Orthologs for TRMU Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for TRMU Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia TRMU 33 34
  • 96.68 (n)
dog
(Canis familiaris)
Mammalia TRMU 34 33
  • 88.3 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Trmu 33 16 34
  • 86.27 (n)
cow
(Bos Taurus)
Mammalia TRMU 33 34
  • 86.22 (n)
rat
(Rattus norvegicus)
Mammalia Trmu 33
  • 86.1 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia TRMU 34
  • 78 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia TRMU 34
  • 75 (a)
OneToOne
chicken
(Gallus gallus)
Aves TRMU 33 34
  • 75.19 (n)
lizard
(Anolis carolinensis)
Reptilia TRMU 34
  • 77 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia trmu 33
  • 73.23 (n)
Str.12914 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.20115 33
zebrafish
(Danio rerio)
Actinopterygii trmu 33 34
  • 66.58 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.3422 33
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP011960 33
  • 55.23 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG3021 33 34
  • 52.43 (n)
worm
(Caenorhabditis elegans)
Secernentea B0035.16 33 34
  • 50.65 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0F24706g 33
  • 45.41 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SLM3 33 34 36
  • 45.38 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AEL087C 33
  • 44.69 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons AT1G51310 33
  • 46.65 (n)
rice
(Oryza sativa)
Liliopsida Os03g0174600 33
  • 46.55 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes SPAC23H4.04 33
  • 47.31 (n)
Species where no ortholog for TRMU was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for TRMU Gene

ENSEMBL:
Gene Tree for TRMU (if available)
TreeFam:
Gene Tree for TRMU (if available)

Paralogs for TRMU Gene

No data available for Paralogs for TRMU Gene

Variants for TRMU Gene

Polymorphic Variants from UniProtKB/Swiss-Prot for TRMU Gene

MTU1_HUMAN-O75648
The polymorphism Ser-10 aggravates the mitochondrial dysfunction associated with a mitochondrial 12S ribosomal RNA (rRNA) A1555G mutation that has been associated with aminoglycoside-induced and non-syndromic deafness [MIM:580000].

Sequence variations from dbSNP and Humsavar for TRMU Gene

SNP ID Clin Chr 22 pos Variation AA Info Type
rs11090865 risk-factor, benign, Deafness, mitochondrial, modifier of, not specified, Liver failure acute infantile 46,335,792(+) G/T 5_prime_UTR_variant, coding_sequence_variant, genic_upstream_transcript_variant, missense_variant, non_coding_transcript_variant, upstream_transcript_variant
rs111830256 uncertain-significance, Liver failure acute infantile 46,357,057(+) C/T 3_prime_UTR_variant, genic_downstream_transcript_variant, non_coding_transcript_variant
rs113302712 benign, Liver failure acute infantile 46,357,049(+) T/C/G 3_prime_UTR_variant, genic_downstream_transcript_variant, non_coding_transcript_variant
rs113846383 benign, uncertain-significance, not specified, Liver failure acute infantile 46,355,470(+) G/T coding_sequence_variant, missense_variant, non_coding_transcript_variant, synonymous_variant
rs114302881 benign, likely-benign, not specified, Liver failure acute infantile 46,335,774(+) T/G 5_prime_UTR_variant, coding_sequence_variant, genic_upstream_transcript_variant, missense_variant, non_coding_transcript_variant, upstream_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for TRMU Gene

Variant ID Type Subtype PubMed ID
dgv2469n106 OTHER inversion 24896259
esv3647951 CNV loss 21293372
nsv1066139 CNV gain 25217958
nsv1066865 CNV gain 25217958
nsv1152661 OTHER inversion 26484159
nsv471214 CNV loss 18288195
nsv524100 CNV loss 19592680
nsv829281 CNV gain 20364138
nsv829293 CNV gain 20364138
nsv834225 CNV loss 17160897
nsv955177 CNV deletion 24416366

Variation tolerance for TRMU Gene

Residual Variation Intolerance Score: 58.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 7.10; 80.50% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for TRMU Gene

Human Gene Mutation Database (HGMD)
TRMU
SNPedia medical, phenotypic, and genealogical associations of SNPs for
TRMU

Disorders for TRMU Gene

MalaCards: The human disease database

(5) MalaCards diseases for TRMU Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, Swiss-Prot, DISEASES, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search TRMU in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

MTU1_HUMAN
  • Liver failure, infantile, transient (LFIT) [MIM:613070]: A transient disorder of hepatic function characterized by elevated liver enzymes, jaundice, vomiting, coagulopathy, hyperbilirubinemia, increased serum lactate. Patients who survive the initial acute episode can recover, show normal development and have no recurrence. {ECO:0000269 PubMed:19732863}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for TRMU

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with TRMU: view

No data available for Genatlas for TRMU Gene

Publications for TRMU Gene

  1. Acute infantile liver failure due to mutations in the TRMU gene. (PMID: 19732863) Zeharia A … Elpeleg O (American journal of human genetics 2009) 3 4 22 58
  2. Mutation in TRMU related to transfer RNA modification modulates the phenotypic expression of the deafness-associated mitochondrial 12S ribosomal RNA mutations. (PMID: 16826519) Guan MX … Fischel-Ghodsian N (American journal of human genetics 2006) 3 4 22 58
  3. Human TRMU encoding the mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase is a putative nuclear modifier gene for the phenotypic expression of the deafness-associated 12S rRNA mutations. (PMID: 16513084) Yan Q … Guan MX (Biochemical and biophysical research communications 2006) 3 4 22 58
  4. Mitochondria-specific RNA-modifying enzymes responsible for the biosynthesis of the wobble base in mitochondrial tRNAs. Implications for the molecular pathogenesis of human mitochondrial diseases. (PMID: 15509579) Umeda N … Suzuki T (The Journal of biological chemistry 2005) 3 4 22 58
  5. Identification and characterization of mouse TRMU gene encoding the mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase. (PMID: 14746906) Yan Q … Guan MX (Biochimica et biophysica acta 2004) 2 3 22 58

Products for TRMU Gene

Sources for TRMU Gene

Content
Loading form....