This gene encodes a large protein that functions as a GDP to GTP exchange factor. This protein promotes the reorganization of the actin cytoskeleton, thereby playing a role in cell migration and growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] See more...

Aliases for TRIO Gene

Aliases for TRIO Gene

  • Trio Rho Guanine Nucleotide Exchange Factor 2 3 5
  • Triple Functional Domain (PTPRF Interacting) 2 3
  • Triple Functional Domain Protein 3 4
  • PTPRF-Interacting Protein 3 4
  • EC 2.7.11.1 4 51
  • ARHGEF23 2 3
  • MEBAS 3
  • MRD44 3
  • MRD63 3
  • Tgat 3
  • TRIO 5

External Ids for TRIO Gene

Previous GeneCards Identifiers for TRIO Gene

  • GC05U990059
  • GC05P014425
  • GC05P014176
  • GC05P014196

Summaries for TRIO Gene

Entrez Gene Summary for TRIO Gene

  • This gene encodes a large protein that functions as a GDP to GTP exchange factor. This protein promotes the reorganization of the actin cytoskeleton, thereby playing a role in cell migration and growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

GeneCards Summary for TRIO Gene

TRIO (Trio Rho Guanine Nucleotide Exchange Factor) is a Protein Coding gene. Diseases associated with TRIO include Intellectual Developmental Disorder, Autosomal Dominant 44, With Microcephaly and Intellectual Developmental Disorder, Autosomal Dominant 63, With Macrocephaly. Among its related pathways are NGF Pathway and RET signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is KALRN.

UniProtKB/Swiss-Prot Summary for TRIO Gene

  • Guanine nucleotide exchange factor (GEF) for RHOA and RAC1 GTPases (PubMed:8643598, PubMed:22155786, PubMed:27418539). Involved in coordinating actin remodeling, which is necessary for cell migration and growth (PubMed:10341202, PubMed:22155786). In developing hippocampal neurons, limits dendrite formation, without affecting the establishment of axon polarity. Once dendrites are formed, involved in the control of synaptic function by regulating the endocytosis of AMPA-selective glutamate receptors (AMPARs) at CA1 excitatory synapses (By similarity). May act as a regulator of adipogenesis (By similarity).

Tocris Summary for TRIO Gene

  • GTPases are a group of enzymes that catalyze hydrolysis of the gamma phosphate bond in guanine triphosphate (GTP) to form guanine diphosphate (GDP). Mg2+ ions are essential for catalytic activity. GTPases, often coupled to G proteins, are essential in signal transduction.

Gene Wiki entry for TRIO Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for TRIO Gene

Genomics for TRIO Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for TRIO Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH05J014138 Promoter/Enhancer 2.4 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 615.4 +1.1 1065 12 ZNF221 SP1 HNRNPL GATAD2A CTCF TEAD4 PRDM10 ZNF629 REST ZNF512 TRIO MN298161 RBBP4P1 MN298162 OTULINL
GH05J014293 Promoter/Enhancer 0.7 EPDnew dbSUPER 610 +149.7 149711 0.1 POLR2A SMARCA4 TRIO HSALNG0040285 RF00017-4514 OTULINL
GH05J014257 Promoter/Enhancer 2 FANTOM5 ENCODE CraniofacialAtlas dbSUPER 24.8 +121.4 121412 13.9 ZNF221 RNF2 CREB1 CTCF ATF7 TEAD4 PRDM10 ZNF629 ZNF512 LEF1 TRIO HSALNG0040285 RF00994-810 OTULINL
GH05J014152 Promoter/Enhancer 1.7 FANTOM5 Ensembl ENCODE dbSUPER 28 +13.3 13285 7.9 CEBPG PRDM10 ZNF629 ZNF692 FOXA1 PRDM1 RELA ZIC2 ZSCAN4 POLR2A TRIO RBBP4P1 MN298162 OTULINL
GH05J014010 Promoter/Enhancer 1.8 EPDnew ENCODE CraniofacialAtlas dbSUPER 20 -131.7 -131745 2.4 PRDM10 RFX1 BACH1 LARP7 PRDM1 RBFOX2 PATZ1 SP1 POLR2A CTCF DNAH5 lnc-DNAH5-5 TRIO RBBP4P1 RF00017-4512
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around TRIO on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for TRIO

Top Transcription factor binding sites by QIAGEN in the TRIO gene promoter:
  • AREB6
  • ATF6
  • C/EBPalpha
  • Egr-1
  • Egr-4
  • Elk-1
  • GATA-1
  • GATA-2
  • GATA-3
  • Pbx1a

Genomic Locations for TRIO Gene

Genomic Locations for TRIO Gene
chr5:14,143,342-14,532,128
(GRCh38/hg38)
Size:
388,787 bases
Orientation:
Plus strand
chr5:14,143,811-14,532,235
(GRCh37/hg19)
Size:
388,425 bases
Orientation:
Plus strand

Genomic View for TRIO Gene

Genes around TRIO on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TRIO Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TRIO Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TRIO Gene

Proteins for TRIO Gene

  • Protein details for TRIO Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O75962-TRIO_HUMAN
    Recommended name:
    Triple functional domain protein
    Protein Accession:
    O75962
    Secondary Accessions:
    • D3DTD1
    • Q13458
    • Q59EQ7
    • Q6PJC9
    • Q6ZN05
    • Q8IWK8

    Protein attributes for TRIO Gene

    Size:
    3097 amino acids
    Molecular mass:
    346900 Da
    Quaternary structure:
    • Interacts with CARMIL1 (PubMed:19846667). Interacts with PTPRF/LAR (PubMed:8643598). Interacts with ANKRD26 (PubMed:22666460). Interacts with Bassoon/BSN and Piccolo/PCLO (By similarity). Interacts with the cytoplasmic region of the heterodimer formed by NGFR and SORCS2. ProNGF binding mediates dissociation of TRIO from the receptor complex (PubMed:22155786).
    SequenceCaution:
    • Sequence=AAC34245.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305}; Sequence=AAC34245.1; Type=Frameshift; Evidence={ECO:0000305}; Sequence=AAC43042.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for TRIO Gene

    Alternative splice isoforms for TRIO Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for TRIO Gene

Selected DME Specific Peptides for TRIO Gene

O75962:
  • NIFLKELEKYEQLPEDVGHCFVTWADKFQMYV
  • KTHQSALQVQQKAE
  • ELNEEKR
  • QRENRVLH
  • IWQHRKVRLHQRLQLCVFQQ
  • GHYASQQI
  • RRKHQND
  • KRRLDQCQQYVVFERSAKQAL
  • LLDMSVSFHTH
  • VCKRGFTVI
  • ANYSKAVH
  • DPCKFAL
  • SPIEYQR
  • KYQLLLK
  • FLQLRIFE
  • LDQCFQLRLFEQDAEKMFDWI
  • LSGVSPFLD
  • IHVALIIKPDNFWQKQ

Post-translational modifications for TRIO Gene

Domains & Families for TRIO Gene

Gene Families for TRIO Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins

Protein Domains for TRIO Gene

InterPro:
Blocks:
  • Immunoglobulin C-2 type
  • Immunoglobulin I-set
  • Pleckstrin-like
  • Variant SH3
  • DH domain
  • Cellular retinaldehyde-binding (CRAL)/Triple function domain (TRIO)
  • Spectrin repeat
ProtoNet:

Suggested Antigen Peptide Sequences for TRIO Gene

GenScript: Design optimal peptide antigens:
  • Triple functional domain (PTPRF interacting), isoform CRA_a (D3DTD2_HUMAN)
  • Transforming gene product TGAT (Q7Z2K2_HUMAN)
  • PTPRF-interacting protein (TRIO_HUMAN)

Graphical View of Domain Structure for InterPro Entry

O75962

UniProtKB/Swiss-Prot:

TRIO_HUMAN :
  • The N-terminal DBL/GEF domain specifically catalyzes nucleotide exchange for RAC1, leading to the activation of Jun kinase and the production of membrane ruffles. The second DBL/GEF domain is an exchange factor for rhoa and induces the formation of stress fibers.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
Domain:
  • The N-terminal DBL/GEF domain specifically catalyzes nucleotide exchange for RAC1, leading to the activation of Jun kinase and the production of membrane ruffles. The second DBL/GEF domain is an exchange factor for rhoa and induces the formation of stress fibers.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
genes like me logo Genes that share domains with TRIO: view

Function for TRIO Gene

Molecular function for TRIO Gene

UniProtKB/Swiss-Prot Function:
Guanine nucleotide exchange factor (GEF) for RHOA and RAC1 GTPases (PubMed:8643598, PubMed:22155786, PubMed:27418539). Involved in coordinating actin remodeling, which is necessary for cell migration and growth (PubMed:10341202, PubMed:22155786). In developing hippocampal neurons, limits dendrite formation, without affecting the establishment of axon polarity. Once dendrites are formed, involved in the control of synaptic function by regulating the endocytosis of AMPA-selective glutamate receptors (AMPARs) at CA1 excitatory synapses (By similarity). May act as a regulator of adipogenesis (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.
GENATLAS Biochemistry:
trio phosphoprotein,with three enzymze domains,binding the LAR transmembrane tyrosine phosphatase (PTPRF),likely involved in active cell migration

Enzyme Numbers (IUBMB) for TRIO Gene

Phenotypes From GWAS Catalog for TRIO Gene

Gene Ontology (GO) - Molecular Function for TRIO Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity TAS,IEA --
GO:0005085 guanyl-nucleotide exchange factor activity IEA,TAS 8643598
GO:0005089 Rho guanyl-nucleotide exchange factor activity IEA,TAS --
genes like me logo Genes that share ontologies with TRIO: view
genes like me logo Genes that share phenotypes with TRIO: view

Human Phenotype Ontology for TRIO Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for TRIO Gene

MGI Knock Outs for TRIO:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TRIO

No data available for Transcription Factor Targets and HOMER Transcription for TRIO Gene

Localization for TRIO Gene

Subcellular locations from UniProtKB/Swiss-Prot for TRIO Gene

Cytoplasm. Cell projection.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TRIO gene
Compartment Confidence
cytosol 5
nucleus 3
plasma membrane 2
extracellular 2
cytoskeleton 2
mitochondrion 1
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Vesicles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for TRIO Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0042995 cell projection IEA --
genes like me logo Genes that share ontologies with TRIO: view

Pathways & Interactions for TRIO Gene

genes like me logo Genes that share pathways with TRIO: view

Pathways by source for TRIO Gene

1 GeneGo (Thomson Reuters) pathway for TRIO Gene
  • Cytoskeleton remodeling Integrin outside-in signaling
2 Qiagen pathways for TRIO Gene
  • NGF Pathway
  • TRKA Signaling

SIGNOR curated interactions for TRIO Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for TRIO Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0007185 transmembrane receptor protein tyrosine phosphatase signaling pathway TAS 8643598
GO:0007186 G protein-coupled receptor signaling pathway TAS --
GO:0007411 axon guidance IEA --
GO:0007417 central nervous system development IEA --
genes like me logo Genes that share ontologies with TRIO: view

Drugs & Compounds for TRIO Gene

(4) Drugs for TRIO Gene - From: HMDB and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Guanosine triphosphate Experimental Pharma 0
Salirasib Investigational Pharma Inhibitor of active Ras protein, Ras inhibitor; also induces autophagy 0
8-CPT-2Me-cAMP, sodium salt Pharma EPAC agonist, selective, Selective Epac activator 0
8-pCPT-2-O-Me-cAMP-AM Pharma Selective Epac activator; cell-permeable analog of 8CPT-2Me-cAMP (Cat. No. 1645) 0

(3) Additional Compounds for TRIO Gene - From: Novoseek and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ESI 09
263707-16-0

(4) Tocris Compounds for TRIO Gene

Compound Action Cas Number
8-CPT-2Me-cAMP, sodium salt Selective Epac activator 634207-53-7
8-pCPT-2-O-Me-cAMP-AM Selective Epac activator; cell-permeable analog of 8CPT-2Me-cAMP (Cat. No. 1645) 1152197-23-3
ESI 09 EPAC inhibitor 263707-16-0
Salirasib Ras inhibitor; also induces autophagy 162520-00-5
genes like me logo Genes that share compounds with TRIO: view

Transcripts for TRIO Gene

mRNA/cDNA for TRIO Gene

1 REFSEQ mRNAs :
15 NCBI additional mRNA sequence :
25 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TRIO

Alternative Splicing Database (ASD) splice patterns (SP) for TRIO Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^
SP1: - -
SP2: - -
SP3:
SP4: -
SP5:
SP6:
SP7: -
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

ExUns: 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31 ^ 32 ^ 33 ^ 34a · 34b ^ 35 ^ 36a · 36b · 36c ^ 37 ^ 38a · 38b ^ 39a · 39b · 39c ^ 40a · 40b ^ 41 ^ 42 ^
SP1: - - - -
SP2: - - - -
SP3: - - - -
SP4: - -
SP5:
SP6: -
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13: -
SP14:
SP15:
SP16:
SP17:

ExUns: 43 ^ 44 ^ 45a · 45b ^ 46 ^ 47 ^ 48a · 48b ^ 49a · 49b ^ 50 ^ 51a · 51b ^ 52a · 52b · 52c · 52d ^ 53a · 53b ^ 54a · 54b ^ 55 ^ 56a · 56b ^ 57a · 57b ^
SP1: - - - - - - - - -
SP2: - - - - - - - -
SP3: - -
SP4:
SP5: - - -
SP6:
SP7:
SP8:
SP9: -
SP10: - - -
SP11:
SP12: -
SP13:
SP14:
SP15:
SP16:
SP17:

ExUns: 58 ^ 59a · 59b ^ 60 ^ 61a · 61b ·
SP1: -
SP2: -
SP3:
SP4:
SP5: -
SP6:
SP7:
SP8:
SP9: - -
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

Relevant External Links for TRIO Gene

GeneLoc Exon Structure for
TRIO

Expression for TRIO Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for TRIO Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for TRIO Gene

This gene is overexpressed in Fetal Brain (33.2) and Adrenal (8.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for TRIO Gene



Protein tissue co-expression partners for TRIO Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for TRIO

SOURCE GeneReport for Unigene cluster for TRIO Gene:

Hs.130031

mRNA Expression by UniProt/SwissProt for TRIO Gene:

O75962-TRIO_HUMAN
Tissue specificity: Widely expressed, with highest levels in heart, skeletal muscle, and brain.

Evidence on tissue expression from TISSUES for TRIO Gene

  • Nervous system(4.8)
  • Kidney(4.4)
  • Lung(3)
  • Intestine(2.6)
  • Liver(2.3)
  • Skin(2.3)
  • Eye(2.2)
  • Pancreas(2.1)
  • Spleen(2.1)
  • Blood(2.1)
  • Heart(2.1)
genes like me logo Genes that share expression patterns with TRIO: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for TRIO Gene

Orthologs for TRIO Gene

This gene was present in the common ancestor of animals.

Orthologs for TRIO Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia TRIO 30 31
  • 99.11 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia TRIO 31
  • 96 (a)
OneToOne
Cow
(Bos Taurus)
Mammalia TRIO 31
  • 94 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia TRIO 31
  • 93 (a)
OneToOne
Dog
(Canis familiaris)
Mammalia TRIO 30 31
  • 90.95 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Trio 30
  • 89.34 (n)
Mouse
(Mus musculus)
Mammalia Trio 30 17 31
  • 89.06 (n)
OneToOne
Chicken
(Gallus gallus)
Aves TRIO 30 31
  • 83.2 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia -- 31
  • 93 (a)
OneToMany
-- 31
  • 92 (a)
OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia trio 30
  • 78 (n)
Str.3582 30
African clawed frog
(Xenopus laevis)
Amphibia Xl.23955 30
Zebrafish
(Danio rerio)
Actinopterygii triob 31
  • 79 (a)
OneToMany
trioa 30 31
  • 75.8 (n)
OneToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006107 30
  • 55.82 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta trio 30 31 32
  • 53.49 (n)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea unc-73 30 32
  • 44.4 (n)
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 29 (a)
OneToMany
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.3253 30
Species where no ortholog for TRIO was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for TRIO Gene

ENSEMBL:
Gene Tree for TRIO (if available)
TreeFam:
Gene Tree for TRIO (if available)
Aminode:
Evolutionary constrained regions (ECRs) for TRIO: view image

Paralogs for TRIO Gene

(22) SIMAP similar genes for TRIO Gene using alignment to 5 proteins:

  • TRIO_HUMAN
  • D3DTD2_HUMAN
  • E7EPJ7_HUMAN
  • E7EWP2_HUMAN
  • F5H228_HUMAN
genes like me logo Genes that share paralogs with TRIO: view

Variants for TRIO Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for TRIO Gene

SNP ID Clinical significance and condition Chr 05 pos Variation AA Info Type
635458 Uncertain Significance: Mental retardation, autosomal dominant 44 14,461,201(+) C/A MISSENSE_VARIANT,NON_CODING_TRANSCRIPT_VARIANT
638405 Uncertain Significance: Mental retardation, autosomal dominant 44 14,359,416(+) C/T MISSENSE_VARIANT,NON_CODING_TRANSCRIPT_VARIANT
666589 Likely Pathogenic: Mental retardation, autosomal dominant 44 14,406,571(+) A/G SPLICE_ACCEPTOR_VARIANT
691462 Uncertain Significance: Pyloric stenosis; Esophageal atresia 14,366,875(+) C/A MISSENSE_VARIANT,NON_CODING_TRANSCRIPT_VARIANT
714992 Likely Benign: not provided 14,143,792(+) G/A MISSENSE_VARIANT,NON_CODING_TRANSCRIPT_VARIANT

Additional dbSNP identifiers (rs#s) for TRIO Gene

Structural Variations from Database of Genomic Variants (DGV) for TRIO Gene

Variant ID Type Subtype PubMed ID
dgv1074e214 CNV gain 21293372
dgv3045n106 CNV tandem duplication 24896259
dgv3046n106 CNV deletion 24896259
dgv3226e59 CNV duplication 20981092
dgv5577n100 CNV gain 25217958
dgv9600n54 CNV loss 21841781
dgv9601n54 CNV gain 21841781
dgv9602n54 CNV gain 21841781
dgv9603n54 CNV loss 21841781
dgv9604n54 CNV gain 21841781
esv1007471 CNV insertion 20482838
esv2138858 CNV deletion 18987734
esv2410391 CNV deletion 18987734
esv2421652 CNV deletion 20811451
esv24520 CNV loss 19812545
esv2537252 CNV deletion 19546169
esv26100 CNV loss 19812545
esv2658101 CNV deletion 23128226
esv2672857 CNV deletion 23128226
esv2676264 CNV deletion 23128226
esv2729808 CNV deletion 23290073
esv2729809 CNV deletion 23290073
esv2729810 CNV deletion 23290073
esv2729811 CNV deletion 23290073
esv2729812 CNV deletion 23290073
esv2729813 CNV deletion 23290073
esv2752061 CNV gain 17911159
esv2760949 CNV gain+loss 21179565
esv3565561 CNV deletion 23714750
esv3604082 CNV gain 21293372
esv3604085 CNV loss 21293372
esv3604086 CNV loss 21293372
esv3894136 CNV gain 25118596
esv3894138 CNV loss 25118596
nsv1018187 CNV gain 25217958
nsv1026914 CNV gain 25217958
nsv1073862 CNV deletion 25765185
nsv1074814 CNV deletion 25765185
nsv1074815 CNV deletion 25765185
nsv1111295 CNV tandem duplication 24896259
nsv1123915 CNV deletion 24896259
nsv1126713 CNV deletion 24896259
nsv1145054 CNV deletion 24896259
nsv1145055 CNV deletion 24896259
nsv442938 CNV loss 18776908
nsv471939 CNV novel sequence insertion 20440878
nsv4724 CNV deletion 18451855
nsv4725 CNV deletion 18451855
nsv511275 CNV gain 21212237
nsv516415 CNV gain+loss 19592680
nsv597228 CNV gain 21841781
nsv597235 CNV loss 21841781
nsv597240 CNV loss 21841781
nsv823008 CNV gain 20364138
nsv823010 CNV loss 20364138
nsv823011 CNV gain 20364138
nsv830209 CNV gain 17160897
nsv830210 CNV gain 17160897
nsv830211 CNV loss 17160897
nsv950650 CNV deletion 24416366
nsv950651 CNV deletion 24416366
nsv958287 CNV deletion 24416366

Variation tolerance for TRIO Gene

Residual Variation Intolerance Score: 0.151% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.56; 65.04% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for TRIO Gene

Human Gene Mutation Database (HGMD)
TRIO
SNPedia medical, phenotypic, and genealogical associations of SNPs for
TRIO

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TRIO Gene

Disorders for TRIO Gene

MalaCards: The human disease database

(8) MalaCards diseases for TRIO Gene - From: UniProtKB/Swiss-Prot, OMIM, ClinVar, GTR, Orphanet, DISEASES, and GeneCards

UniProtKB/Swiss-Prot

TRIO_HUMAN
  • Mental retardation, autosomal dominant 44 (MRD44) [MIM:617061]: A form of mental retardation, a disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. MRD44 patients manifest developmental delay, variable intellectual disability, distinctive facial features, and abnormalities of the fingers. Most patients also have microcephaly. {ECO:0000269 PubMed:26721934, ECO:0000269 PubMed:27418539}. Note=The disease may be caused by mutations affecting the gene represented in this entry.

Additional Disease Information for TRIO

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with TRIO: view

No data available for Genatlas for TRIO Gene

Publications for TRIO Gene

  1. NMR structure and mutagenesis of the N-terminal Dbl homology domain of the nucleotide exchange factor Trio. (PMID: 9790533) Liu X … Fesik SW (Cell 1998) 3 4 23
  2. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains. (PMID: 8643598) Debant A … Streuli M (Proceedings of the National Academy of Sciences of the United States of America 1996) 2 3 4
  3. TRIO loss of function is associated with mild intellectual disability and affects dendritic branching and synapse function. (PMID: 26721934) Ba W … De Vries BB (Human molecular genetics 2016) 3 4
  4. ANKRD26 and its interacting partners TRIO, GPS2, HMMR and DIPA regulate adipogenesis in 3T3-L1 cells. (PMID: 22666460) Liu XF … Pastan I (PloS one 2012) 3 4
  5. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41

Products for TRIO Gene

Sources for TRIO Gene