Aliases for TGFBR1 Gene
Aliases for TGFBR1 Gene
- Transforming Growth Factor Beta Receptor 1 2 3 5
- Activin A Receptor Type II-Like Protein Kinase Of 53kD 3 4
- Transforming Growth Factor-Beta Receptor Type I 3 4
- Activin A Receptor Type II-Like Kinase, 53kDa 2 3
- Serine/Threonine-Protein Kinase Receptor R4 3 4
- Transforming Growth Factor Beta Receptor I 2 3
- Activin Receptor-Like Kinase 5 3 4
- EC 2.7.11.30 4 56
- TbetaR-I 3 4
- TGFR-1 3 4
- ALK-5 3 4
- ALK5 3 4
- SKR4 3 4
- Mutant Transforming Growth Factor Beta Receptor I 3
- Multiple Self-Healing Squamous Epithelioma 2
External Ids for TGFBR1 Gene
- HGNC: 11772
- Entrez Gene: 7046
- Ensembl: ENSG00000106799
- OMIM: 190181
- UniProtKB: P36897
Previous HGNC Symbols for TGFBR1 Gene
- MSSE
- ESS1
Previous GeneCards Identifiers for TGFBR1 Gene
- GC09P092667
- GC09P093610
- GC09P095324
- GC09P097247
- GC09P098946
- GC09P100907
- GC09P101867
- GC09P071464
Summaries for TGFBR1 Gene
-
The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
GeneCards Summary for TGFBR1 Gene
TGFBR1 (Transforming Growth Factor Beta Receptor 1) is a Protein Coding gene. Diseases associated with TGFBR1 include Multiple Self-Healing Squamous Epithelioma and Loeys-Dietz Syndrome 1. Among its related pathways are Apoptotic Pathways in Synovial Fibroblasts and PEDF Induced Signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is ACVR1B.
UniProtKB/Swiss-Prot for TGFBR1 Gene
-
Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation.
-
The transforming growth factor-beta family of polypeptides (TGF-beta1-3) are involved in the regulation of cellular processes, including division, differentiation, motility, adhesion and death. TGF-beta signals by binding the type II receptor (TGF-betaRII) which activates the type I receptor (TGF-betaRI).
Additional gene information for TGFBR1 Gene
- Monarch Initiative
- Search for TGFBR1 at DataMed
- Search for TGFBR1 at HumanCyc
No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TGFBR1 Gene
Genomics for TGFBR1 Gene
GeneHancer (GH) Regulatory Elements for TGFBR1 Gene
Promoters and enhancers for TGFBR1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around TGFBR1 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the TGFBR1 gene promoter:
Regulatory Element Products
Genomic Locations for TGFBR1 Gene
Genomic Locations for TGFBR1 Gene
- chr9:99,104,038-99,154,192
- (GRCh38/hg38)
- Size:
- 50,155 bases
- Orientation:
- Plus strand
- chr9:101,866,320-101,916,474
- (GRCh37/hg19)
Genomic View for TGFBR1 Gene
Genes around TGFBR1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 9q22.33 by Ensembl
- 9q22.33 by Entrez Gene
- 9q22.33 by HGNC
TGFBR1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for TGFBR1 Gene
Proteins for TGFBR1 Gene
-
Protein details for TGFBR1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P36897-TGFR1_HUMAN
- Recommended name:
- TGF-beta receptor type-1
- Protein Accession:
- P36897
- Q6IR47
- Q706C0
- Q706C1
Protein attributes for TGFBR1 Gene
- Size:
- 503 amino acids
- Molecular mass:
- 55960 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Homodimer; in the endoplasmic reticulum but also at the cell membrane. Heterohexamer; TGFB1, TGFB2 and TGFB3 homodimeric ligands assemble a functional receptor composed of two TGFBR1 and TGFBR2 heterodimers to form a ligand-receptor heterohexamer. The respective affinity of TGBRB1 and TGFBR2 for the ligands may modulate the kinetics of assembly of the receptor and may explain the different biological activities of TGFB1, TGFB2 and TGFB3. Interacts with CD109; inhibits TGF-beta receptor activation in keratinocytes. Interacts with RBPMS. Interacts (unphosphorylated) with FKBP1A; prevents TGFBR1 phosphorylation by TGFBR2 and stabilizes it in the inactive conformation. Interacts with SMAD2, SMAD3 and ZFYVE9; ZFYVE9 recruits SMAD2 and SMAD3 to the TGF-beta receptor. Interacts with TRAF6 and MAP3K7; induces MAP3K7 activation by TRAF6. Interacts with PARD6A; involved in TGF-beta induced epithelial to mesenchymal transition. Interacts with SMAD7, NEDD4L, SMURF1 and SMURF2; SMAD7 recruits NEDD4L, SMURF1 and SMURF2 to the TGF-beta receptor. Interacts with USP15 and VPS39. Interacts with SDCBP (via C-terminus) (PubMed:25893292) Interacts with CAV1 and this interaction is impaired in the presence of SDCBP (PubMed:25893292).
Three dimensional structures from OCA and Proteopedia for TGFBR1 Gene
Protein Expression for TGFBR1 Gene
Selected DME Specific Peptides for TGFBR1 Gene
- P36897:
-
- HRDLKSKNILVKKNG
- GMIKLALS
- RHENILGFIAAD
- RVGTKRYM
- KPAIAHRD
- IADLGLA
- ARTIVLQE
- FESFKRADIY
- VAVKIFSSR
- IADLGLAVRHD
- PLLVQRTIA
- IGKGRFGEVWRG
- RPNIPNRW
- SGSGSGLP
- ASGLAHLH
- TDTIDIAPN
- MRECWYANGAARLTALRIKKTLSQLS
- GLGPVELAAVIAGPVCFVCI
- TDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAP
- RYMAPEVL
- YMAPEVL
- CCIADLGLA
- TLKDLIYD
Post-translational modifications for TGFBR1 Gene
- N-Glycosylated.
- Phosphorylated at basal levels in the absence of ligand. Activated upon phosphorylation by TGFBR2, mainly in the GS domain. Phosphorylation in the GS domain abrogates FKBP1A-binding.
- Ubiquitinated; undergoes ubiquitination catalyzed by several E3 ubiquitin ligases including SMURF1, SMURF2 and NEDD4L2. Results in the proteasomal and/or lysosomal degradation of the receptor thereby negatively regulating its activity. Deubiquitinated by USP15, leading to stabilization of the protein and enhanced TGF-beta signal. Its ubiquitination and proteasome-mediated degradation is negatively regulated by SDCBP (PubMed:25893292).
- Glycosylation at isoforms=2, 345
Other Protein References for TGFBR1 Gene
Antibody Products
- R&D Systems Antibodies for TGFBR1 (TGF-beta RI/ALK-5)
- Cell Signaling Technology (CST) Antibodies for TGFBR1 (TGFBR1)
-
Custom Antibody ServicesOriGene Antibodies for TGFBR1
- Novus Biologicals Antibodies for TGFBR1
-
Abcam antibodies for TGFBR1
-
Cloud-Clone Corp. Antibodies for TGFBR1
- Invitrogen Antibodies for TGFBR1
- antibodies-online: Search results for 147 available TGFBR1 Antibodies ranked by validation data
- Compare Top TGFBR1 Antibodies
-
Recommended
- 1 FACS Antibody (anti-rat)
- 2 IF Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 31 WB Antibodies (anti-rat)
- 2 IF Antibodies (anti-mouse)
- 5 FACS Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 65 WB Antibodies (anti-mouse)
- 1 FACS Antibody (anti-human)
- 2 IF Antibodies (anti-human)
- 4 IHC Antibodies (anti-human)
- 6 IHC (p) Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 83 WB Antibodies (anti-human)
- Search GeneTex for Antibodies for TGFBR1
- Sino Biological Antibodies for TGFBR1
Protein Products
- R&D Systems Proteins and Enzymes for TGFBR1 (TGF-beta RI/ALK-5)
-
OriGene Purified Proteins for TGFBR1
- Search Origene for MassSpec and Protein Over-expression Lysates for TGFBR1
- Origene Custom Protein Services for TGFBR1
- Sino Biological Cell Lysates for TGFBR1
- Sino Biological Recombinant Proteins for TGFBR1
-
Cloud-Clone Corp. Proteins for TGFBR1
- Search GeneTex for Proteins for TGFBR1
-
Abcam proteins for TGFBR1
Assay Products
-
Cloud-Clone Corp. Assay Kits for TGFBR1
Domains & Families for TGFBR1 Gene
Gene Families for TGFBR1 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- Potential drug targets
- Predicted intracellular proteins
- Predicted membrane proteins
- Predicted secreted proteins
Protein Domains for TGFBR1 Gene
Suggested Antigen Peptide Sequences for TGFBR1 Gene
- GenScript: Design optimal peptide antigens:
-
- Mutant transforming growth factor beta receptor I (A6MIV6_HUMAN)
- Mutant transforming growth factor beta receptor I (A6MIV7_HUMAN)
- cDNA FLJ61454, highly similar to TGF-beta receptor type-1 (EC 2.7.11.30) (B4DXN7_HUMAN)
- cDNA FLJ58645, highly similar to TGF-beta receptor type-1 (EC 2.7.11.30) (B4DY26_HUMAN)
- Transforming growth factor, beta receptor I (Activin A receptor type II-like kinase, 53kDa), isoform CRA_a (Q5T7S2_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P36897UniProtKB/Swiss-Prot:
TGFR1_HUMAN :- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
Function for TGFBR1 Gene
Molecular function for TGFBR1 Gene
- GENATLAS Biochemistry:
- transforming growth factor beta,receptor type I,regulating cell cycle progression,including two variants TGFBR1,6A and TGFBR1,10A,inactivated in pancreatic and biliary cancers,deleted in cutaneous T cell lymphoma
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + [receptor-protein] = ADP + [receptor-protein] phosphate.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Kept in an inactive conformation by FKBP1A preventing receptor activation in absence of ligand. CD109 is another inhibitor of the receptor.
- UniProtKB/Swiss-Prot Function:
- Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation.
Enzyme Numbers (IUBMB) for TGFBR1 Gene
Phenotypes From GWAS Catalog for TGFBR1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004672 | protein kinase activity | IDA,IEA | 19736306 |
| GO:0004674 | protein serine/threonine kinase activity | IEA,IDA | 12065756 |
| GO:0004675 | transmembrane receptor protein serine/threonine kinase activity | IEA | -- |
| GO:0004702 | signal transducer, downstream of receptor, with serine/threonine kinase activity | IEA | -- |
| GO:0005024 | contributes_to transforming growth factor beta-activated receptor activity | IEA,IMP | 1333888 |
Phenotypes for TGFBR1 Gene
- MGI mutant phenotypes for TGFBR1:
-
inferred from 9 alleles
- nervous system phenotype
- normal phenotype
- homeostasis/metabolism phenotype
- respiratory system phenotype
- muscle phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- growth/size/body region phenotype
- neoplasm
- digestive/alimentary phenotype
- endocrine/exocrine gland phenotype
- integument phenotype
- embryo phenotype
- hematopoietic system phenotype
- skeleton phenotype
- GenomeRNAi human phenotypes for TGFBR1:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Decreased JFH-1 genotype 2a Hepatitis C virus (HCV) infection
- Increased G1 DNA content
- G0/1 arrest
- Transferrin accumulation in the perinuclear area
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Decreased vesicular stomatitis virus (VSV) infection
- Decreased substrate adherent cell growth
- Decreased shRNA abundance (Z-score < -2)
- Decreased infection with West Nile virus (WNV)
- Decreased West Nile virus (WNV) infection
- Downregulation of Wnt pathway after Wnt3A stimulation
- Decreased Salmonella proliferation
- Condensed cis-Golgi
- Increased colony dispersion (increased number of colonies and decreased number of cells per colony)
Animal Models for TGFBR1 Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for TGFBR1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for TGFBR1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for TGFBR1 gene
- Search ViGene Biosciences for TGFBR1
CRISPR Products
-
OriGene CRISPR knockouts for TGFBR1
- genomics-online: gRNA clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
- Applied Biological Materials CRISPR for TGFBR1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for TGFBR1
- GenScript: Design CRISPR guide RNA sequences for TGFBR1
miRNA for TGFBR1 Gene
- miRTarBase miRNAs that target TGFBR1
-
- hsa-let-7c-5p (MIRT000687)
- hsa-mir-204-5p (MIRT003271)
- hsa-mir-128-3p (MIRT004650)
- hsa-mir-140-5p (MIRT007379)
- hsa-mir-142-3p (MIRT021634)
- hsa-mir-101-3p (MIRT027382)
- hsa-mir-98-5p (MIRT027865)
- hsa-let-7d-5p (MIRT032178)
- hsa-let-7f-5p (MIRT053633)
- hsa-mir-130a-3p (MIRT053635)
- hsa-mir-181a-5p (MIRT053663)
- hsa-let-7g-5p (MIRT054663)
- hsa-let-7b-5p (MIRT054832)
- hsa-mir-1343-3p (MIRT106691)
- hsa-mir-6783-3p (MIRT106693)
- hsa-mir-202-5p (MIRT173470)
- hsa-mir-1283 (MIRT173481)
- hsa-mir-4668-5p (MIRT173515)
- hsa-mir-8083 (MIRT173532)
- hsa-mir-27a-3p (MIRT323787)
- hsa-mir-216a-3p (MIRT323788)
- hsa-mir-27b-3p (MIRT323789)
- hsa-mir-3681-3p (MIRT323791)
- hsa-mir-3927-3p (MIRT372394)
- hsa-mir-6831-5p (MIRT372395)
- hsa-mir-376c-3p (MIRT437849)
- hsa-mir-135b-5p (MIRT438737)
- hsa-mir-6826-3p (MIRT466408)
- hsa-mir-6795-3p (MIRT466409)
- hsa-mir-6887-3p (MIRT466410)
- hsa-mir-3156-5p (MIRT466411)
- hsa-mir-4480 (MIRT496743)
- hsa-mir-8063 (MIRT496744)
- hsa-mir-6888-3p (MIRT698502)
- hsa-mir-466 (MIRT698503)
- hsa-mir-6739-5p (MIRT698504)
- hsa-mir-6733-5p (MIRT698505)
- hsa-mir-3153 (MIRT698506)
- hsa-mir-4646-5p (MIRT698507)
- hsa-mir-204-3p (MIRT698508)
- hsa-mir-6742-3p (MIRT698509)
- hsa-mir-6852-5p (MIRT698510)
- hsa-mir-939-3p (MIRT698511)
- hsa-mir-4643 (MIRT698512)
- hsa-mir-4789-3p (MIRT698513)
- hsa-mir-3529-5p (MIRT698514)
- hsa-mir-379-5p (MIRT698515)
- hsa-mir-490-3p (MIRT732226)
- gga-let-7a-5p (MIRT733628)
- gga-let-7b (MIRT733631)
- hsa-mir-20a-5p (MIRT734034)
- hsa-mir-181c-5p (MIRT734924)
- hsa-mir-199a-5p (MIRT735136)
miRNA Products
- Search ViGene Biosciences for TGFBR1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for TGFBR1
- Browse OriGene Inhibitory RNA Products For TGFBR1
- genomics-online: shRNA clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for TGFBR1 gene
Clone Products
- Sino Biological Human cDNA Clone for TGFBR1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for TGFBR1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for TGFBR1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for TGFBR1
- Applied Biological Materials Clones for TGFBR1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
- R&D Systems cDNA Clones for TGFBR1 (TGF-beta RI/ALK-5)
Cell Line Products
-
Horizon Cell Lines for TGFBR1
-
ViGene Biosciences adenoviral particle packaged cDNA for TGFBR1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for TGFBR1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for TGFBR1 gene
No data available for Transcription Factor Targets and HOMER Transcription for TGFBR1 Gene
Localization for TGFBR1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for TGFBR1 Gene
- Cell membrane; Single-pass type I membrane protein. Cell junction, tight junction. Cell surface. Membrane raft.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| extracellular | 3 |
| nucleus | 2 |
| endoplasmic reticulum | 2 |
| endosome | 2 |
| cytoskeleton | 1 |
| peroxisome | 1 |
- Plasma membrane (3)
- Vesicles (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005623 | cell | ISS | -- |
| GO:0005768 | endosome | IEA | -- |
| GO:0005886 | plasma membrane | IDA,TAS | -- |
| GO:0005923 | bicellular tight junction | IEA,IDA | 15761148 |
| GO:0009986 | cell surface | IEA,IDA | 25893292 |
Pathways & Interactions for TGFBR1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Apoptotic Pathways in Synovial Fibroblasts |
.74
|
.66
.65
.61
.60
|
| 2 | SMAD2/3 MH2 Domain Mutants in Cancer | ||
| 3 | Apoptosis Pathway |
.39
|
|
| 4 | PAK Pathway |
.56
|
|
| 5 | TGF-beta receptor signaling activates SMADs | ||
Pathways by source for TGFBR1 Gene
2 GeneTex pathways for TGFBR1 Gene
2 Cell Signaling Technology pathways for TGFBR1 Gene
13 BioSystems pathways for TGFBR1 Gene
21 Reactome pathways for TGFBR1 Gene
9 GeneGo (Thomson Reuters) pathways for TGFBR1 Gene
2 R&D Systems pathways for TGFBR1 Gene
4 Tocris pathways for TGFBR1 Gene
Interacting Proteins for TGFBR1 Gene
Selected Interacting proteins:
ENSP00000364133
P36897-TGFR1_HUMAN
for TGFBR1 Gene via
STRING
MINT
IID
UniProtKB
SIGNOR curated interactions for TGFBR1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000186 | activation of MAPKK activity | IDA | 18625725 |
| GO:0001501 | skeletal system development | ISS,IEA | -- |
| GO:0001525 | angiogenesis | IEA | -- |
| GO:0001701 | in utero embryonic development | ISS,IEA | -- |
| GO:0001822 | kidney development | ISS,IEA | -- |
Drugs & Compounds for TGFBR1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Pirfenidone | Approved, Investigational | Pharma | TGF-β production inhibitor, Antifibrotic agent; regulates cytokine levels in vivo | 65 | ||
| Magnesium | Approved | Nutra | 0 | |||
| Manganese | Approved | Nutra | 37 | |||
| 2-(6-methylpyridin-2-yl)-N-pyridin-4-ylquinazolin-4-amine | Experimental | Pharma | Target | 0 | ||
| 3-(4-Fluorophenyl)-2-(6-Methylpyridin-2-Yl)-5,6-Dihydro-4h-Pyrrolo[1,2-B]Pyrazole | Experimental | Pharma | Target | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
(5) Tocris Compounds for TGFBR1 Gene
| Compound | Action | Cas Number |
|---|---|---|
| A 83-01 | Selective inhibitor of TGF-betaRI, ALK4 and ALK7 | 909910-43-6 |
| RepSox | Potent and selective inhibitor of TGF-betaRI | 446859-33-2 |
| SB 431542 | Potent, selective inhibitor of TGF-betaRI, ALK4 and ALK7 | 301836-41-9 |
| SB 505124 | Selective inhibitor of TGF-betaRI, ALK4 and ALK7 | 694433-59-5 |
| SIS3 | Selective Smad3 inhibitor; inhibits TGF-betaR1 signaling | 521984-48-5 |
(16) ApexBio Compounds for TGFBR1 Gene
| Compound | Action | Cas Number |
|---|---|---|
| A 77-01 | Potent ALK5 inhibitor | 607737-87-1 |
| A 83-01 | ALK-5 inhibitor | 909910-43-6 |
| GW788388 | ALK5 inhibitor,potent and selective | 452342-67-5 |
| K02288 | ALK inhibitor | 1431985-92-0 |
| LDN-212854 | BMP receptor inhibitor,potent and selective | 1432597-26-6 |
| LY2109761 | TβRI/II kinase inhibitor | 700874-71-1 |
| LY2157299 | TGF-βR1 inhibitor,potent and selective | 700874-72-2 |
| LY364947 | 396129-53-6 | |
| ML347 | BMP receptor inhibitor,potent and selective | 1062368-49-3 |
| Pirfenidone | TGF-β production inhibitor | 53179-13-8 |
| RepSox | ALK5 inhibitor,potent and selective | 446859-33-2 |
| SB 431542 | ALK inhibitor | 301836-41-9 |
| SB505124 | ALK4/ALK5/ALK7 inhibitor | 694433-59-5 |
| SB-505124 hydrochloride | ALK5/ALK4/ALK7 inhibitor in TGF-β/activin signalling,selective | 356559-13-2 |
| SB525334 | (TGF-beta1) receptor inhibitor | 356559-20-1 |
| SD-208 | TGF-βR I kinase inhibitor | 627536-09-8 |
Transcripts for TGFBR1 Gene
mRNA/cDNA for TGFBR1 Gene
- (7) REFSEQ mRNAs :
- (13) Additional mRNA sequences :
- (228) Selected AceView cDNA sequences:
- (10) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for TGFBR1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for TGFBR1
- genomics-online: gRNA clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
- Applied Biological Materials CRISPR for TGFBR1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for TGFBR1
- GenScript: Design CRISPR guide RNA sequences for TGFBR1
miRNA Products
- Search ViGene Biosciences for TGFBR1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for TGFBR1
- Browse OriGene Inhibitory RNA Products For TGFBR1
- genomics-online: shRNA clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for TGFBR1 gene
Clone Products
- Sino Biological Human cDNA Clone for TGFBR1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for TGFBR1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for TGFBR1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for TGFBR1
- Applied Biological Materials Clones for TGFBR1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
- R&D Systems cDNA Clones for TGFBR1 (TGF-beta RI/ALK-5)
| ExUns: | 1a | · | 1b | ^ | 2a | · | 2b | ^ | 3a | · | 3b | · | 3c | ^ | 4a | · | 4b | ^ | 5a | · | 5b | · | 5c | · | 5d | ^ | 6a | · | 6b | ^ | 7a | · | 7b | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11a | · | 11b | · | 11c |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||
| SP3: | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||
| SP6: | - | ||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP9: | - |
Expression for TGFBR1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Bone (Muscoskeletal System)
- Hypertrophic Chondrocytes Vertebrae
- Endochondral Preosteoblasts Rib
- Endochondral Preosteoblasts Vertebrae
- Hypertrophic Chondrocytes Rib
-
Epithelial Cells
- Adult Corneal Superbasal Epithelial Cells Corneal Epithelium
- Adult Corneal Basal Epithelial Cells Corneal Epithelium
- Limbal Superbasal Epithelial Cells Limbus Epithelium
- Duct Cells Pancreatic Ducts
-
Smooth Muscle (Muscoskeletal System)
- Vascular Smooth Muscle Cells Splanchnic Mesoderm
- Vascular Smooth Muscle Cells Veins
- Vascular Smooth Muscle Cells Aortic Arch Arteries
-
Eye (Sensory Organs)
- Adult Corneal Superbasal Epithelial Cells Corneal Epithelium
- Adult Corneal Basal Epithelial Cells Corneal Epithelium
- Limbal Superbasal Epithelial Cells Limbus Epithelium
-
Cartilage (Muscoskeletal System)
- Hypertrophic Chondrocytes Vertebrae
- Hypertrophic Chondrocytes Rib
- Brain (Nervous System)
-
Lateral Plate Mesoderm (Gastrulation Derivatives)
- Vascular Smooth Muscle Cells Splanchnic Mesoderm
-
Zygote (Early Embryonic Tissues)
- Zygote Zygote
-
Inner Cell Mass (Early Embryo)
- Zygote Zygote
-
Trophoblast (Extraembryonic Tissues)
- Zygote Zygote
- Endothelium (Cardiovascular System)
-
Heart (Cardiovascular System)
- Vascular Smooth Muscle Cells Aortic Arch Arteries
-
Pancreas (Endocrine System)
- Duct Cells Pancreatic Ducts
- Intermediate Mesoderm (Gastrulation Derivatives)
- Neural Tube (Nervous System)
- Kidney (Urinary System)
- Limb (Muscoskeletal System)
This gene is overexpressed in Breast (40.3) and Placenta (19.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TGFBR1 Gene
NURSA nuclear receptor signaling pathways regulating expression of TGFBR1 Gene:
TGFBR1SOURCE GeneReport for Unigene cluster for TGFBR1 Gene:
Hs.494622mRNA Expression by UniProt/SwissProt for TGFBR1 Gene:
P36897-TGFR1_HUMAN
Tissue specificity:
Found in all tissues examined, most abundant in placenta and least abundant in brain and heart. Expressed in a variety of cancer cell lines (PubMed:25893292).
Evidence on tissue expression from TISSUES for TGFBR1 Gene
- Nervous system(3.1)
- Heart(2.8)
- Lung(2.7)
- Kidney(2.6)
- Muscle(2.5)
- Liver(2.2)
- Skin(2.1)
Phenotype-based relationships between genes and organs from Gene ORGANizer for TGFBR1 Gene
Germ Layers:
- ectoderm
- endoderm
- mesoderm
Systems:
- cardiovascular
- digestive
- integumentary
- nervous
- reproductive
- respiratory
- skeletal muscle
- skeleton
Regions:
Head and neck:
- brain
- cheek
- chin
- cranial nerve
- ear
- eye
- eyelid
- face
- head
- jaw
- mandible
- maxilla
- meninges
- mouth
- pharynx
- skull
Thorax:
- aorta
- chest wall
- heart
- heart valve
- lung
- rib
- rib cage
- sternum
Abdomen:
- abdominal wall
- intestine
Pelvis:
- pelvis
- uterus
Limb:
- ankle
- digit
- elbow
- finger
- foot
- hand
- hip
- knee
- lower limb
- shoulder
- toe
- upper limb
- wrist
General:
- blood
- blood vessel
- peripheral nervous system
- skin
- spinal column
- vertebrae
Primer Products
-
OriGene qPCR primer pairs for TGFBR1
-
OriGene qPCR primer pairs and template standards for TGFBR1
- genomics-online: primer clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
No data available for mRNA differential expression in normal tissues for TGFBR1 Gene
Orthologs for TGFBR1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | TGFBR1 33 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | TGFBR1 34 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | TGFBR1 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | TGFBR1 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Tgfbr1 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Tgfbr1 33 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | TGFBR1 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | CHALK5 34 |
|
OneToOne | |
| TGFBR1 33 |
|
||||
| lizard (Anolis carolinensis) |
Reptilia | TGFBR1 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | tgfbr1 33 |
|
||
| Str.6441 33 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.996 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | tgfbr1a 34 |
|
OneToMany | |
| tgfbr1b 33 34 |
|
||||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP008247 33 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | babo 35 33 34 |
|
||
| sax 35 |
|
|
|||
| tkv 35 |
|
|
|||
| worm (Caenorhabditis elegans) |
Secernentea | daf-1 35 |
|
|
|
| sma-6 35 |
|
|
|||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany | |
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.7011 33 |
|
- Species where no ortholog for TGFBR1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for TGFBR1 Gene
Paralogs for TGFBR1 Gene
(10) SIMAP similar genes for TGFBR1 Gene using alignment to 11 proteins:
Pseudogenes.org Pseudogenes for TGFBR1 Gene
Variants for TGFBR1 Gene
| SNP ID | Clin | Chr 09 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1021523079 | uncertain-significance, Thoracic aortic aneurysm and aortic dissection | 99,105,251(+) | G/A | coding_sequence_variant, genic_upstream_transcript_variant, intron_variant, missense_variant | |
| rs1046058348 | uncertain-significance, Loeys-Dietz syndrome, Loeys-Dietz syndrome 1, Thoracic aortic aneurysm and aortic dissection | 99,151,584(+) | T/C | 3_prime_UTR_variant, genic_downstream_transcript_variant | |
| rs1057524497 | likely-pathogenic, pathogenic, not provided, Thoracic aortic aneurysm and aortic dissection | 99,138,017(+) | G/A/T | coding_sequence_variant, missense_variant, stop_gained | |
| rs1060502040 | pathogenic, Thoracic aortic aneurysm and aortic dissection | 99,132,634(+) | C/T | coding_sequence_variant, intron_variant, stop_gained | |
| rs1060502042 | uncertain-significance, Thoracic aortic aneurysm and aortic dissection | 99,137,963(+) | G/A | coding_sequence_variant, missense_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| nsv950918 | CNV | duplication | 24416366 |
| nsv831666 | CNV | gain | 17160897 |
| nsv1144284 | CNV | deletion | 24896259 |
| nsv1076195 | CNV | deletion | 25765185 |
| esv3621214 | CNV | gain | 21293372 |
Residual Variation Intolerance Score:
17.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.59;
12.67% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for TGFBR1 Gene
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TGFBR1 Gene
Disorders for TGFBR1 Gene
(29) MalaCards diseases for TGFBR1 Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, Swiss-Prot, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| multiple self-healing squamous epithelioma |
|
|
| loeys-dietz syndrome 1 |
|
|
| loeys-dietz syndrome |
|
|
| aortic aneurysm |
|
|
| aneurysm |
|
|
Search TGFBR1 in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
TGFR1_HUMAN- Loeys-Dietz syndrome 1 (LDS1) [MIM:609192]: An aortic aneurysm syndrome with widespread systemic involvement, characterized by arterial tortuosity and aneurysms, hypertelorism, and bifid uvula or cleft palate. Physical findings include prominent joint laxity, easy bruising, wide and atrophic scars, velvety and translucent skin with easily visible veins, spontaneous rupture of the spleen or bowel, and catastrophic complications of pregnancy, including rupture of the gravid uterus and the arteries, either during pregnancy or in the immediate postpartum period. Some patients have craniosynostosis, exotropy, micrognathia and retrognathia, structural brain abnormalities, and intellectual deficit. {ECO:0000269 PubMed:15731757, ECO:0000269 PubMed:16596670, ECO:0000269 PubMed:16791849, ECO:0000269 PubMed:16928994, ECO:0000269 PubMed:19883511, ECO:0000269 PubMed:22113417}. Note=The disease is caused by mutations affecting the gene represented in this entry. TGFBR1 mutation Gln-487 has been reported to be associated with thoracic aortic aneurysms and dissection (TAAD) (PubMed:16791849). This phenotype, also known as thoracic aortic aneurysms type 5 (AAT5), is distinguised from LDS1 by having aneurysms restricted to thoracic aorta. It is unclear, however, if this condition is fulfilled in individuals bearing Gln-487 mutation, that is why they are considered as LDS1 by the OMIM resource. {ECO:0000269 PubMed:16791849}.
- Multiple self-healing squamous epithelioma (MSSE) [MIM:132800]: A disorder characterized by multiple skin tumors that undergo spontaneous regression. Tumors appear most often on sun-exposed regions, are locally invasive, and undergo spontaneous resolution over a period of months leaving pitted scars. {ECO:0000269 PubMed:21358634}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for TGFBR1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for TGFBR1 Gene
Publications for TGFBR1 Gene
- Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1. (PMID: 21358634) Goudie DR … Lane EB (Nature genetics 2011) 2 3 4 58
- Association of the TGF-beta receptor genes with abdominal aortic aneurysm. (PMID: 19672284) Baas AF … Ruigrok YM (European journal of human genetics : EJHG 2010) 3 22 44 58
- ACE and TGFBR1 genes interact in influencing the susceptibility to abdominal aortic aneurysm. (PMID: 18550062) Lucarini L … Fatini C (Atherosclerosis 2009) 3 22 44 58
- TGFB1 and TGFBR1 polymorphic variants in relationship to bladder cancer risk and prognosis. (PMID: 19004027) Castillejo A … Real FX (International journal of cancer 2009) 3 22 44 58
- TGFBR1 variants TGFBR1(*)6A and Int7G24A are not associated with an increased familial colorectal cancer risk. (PMID: 19401691) Skoglund Lundin J … Lindblom A (British journal of cancer 2009) 3 22 44 58
Products for TGFBR1 Gene
- R&D Systems Antibodies for TGFBR1 (TGF-beta RI/ALK-5)
- R&D Systems Proteins and Enzymes for TGFBR1 (TGF-beta RI/ALK-5)
- Browse R&D Systems for biochemical assays
- R&D Systems cDNA Clones for TGFBR1 (TGF-beta RI/ALK-5)
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for TGFBR1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for TGFBR1
- Search Origene for MassSpec and Protein Over-expression Lysates for TGFBR1
- Origene Custom Protein Services for TGFBR1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for TGFBR1
- Browse OriGene Inhibitory RNA Products For TGFBR1
- OriGene qPCR primer pairs and template standards for TGFBR1
- OriGene qPCR primer pairs for TGFBR1
- OriGene CRISPR knockouts for TGFBR1
- OriGene ORF clones in human for TGFBR1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For TGFBR1
- GenScript: Next-day shipping of latest version cDNA ORF clones for TGFBR1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for TGFBR1
- GenScript Custom Assay Services for TGFBR1
- GenScript Custom overexpressing Cell Line Services for TGFBR1
- GenScript: Design CRISPR guide RNA sequences for TGFBR1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for TGFBR1
- Cell Signaling Technology (CST) Antibodies for TGFBR1 (TGFBR1)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for TGFBR1
- Sino Biological Recombinant Proteins for TGFBR1
- Sino Biological Cell Lysates for TGFBR1
- Sino Biological Antibodies for TGFBR1
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for TGFBR1
- Novus Biologicals lysates and proteins for TGFBR1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for TGFBR1
- Abcam proteins for TGFBR1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for TGFBR1
- Cloud-Clone Corp. Proteins for TGFBR1
- Cloud-Clone Corp. Assay Kits for TGFBR1
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for TGFBR1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for TGFBR1
- Cyagen custom Knockout/knockin (KOKI) mouse models for TGFBR1
- VectorBuilder custom plasmid, inducible vectors for TGFBR1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for TGFBR1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for TGFBR1
- antibodies-online: Search results for 147 available TGFBR1 Antibodies ranked by validation data
- Compare Top TGFBR1 Antibodies
- Recommended
- 83 WB Antibodies (anti-human)
- 12 IF (p) Antibodies (anti-human)
- 6 IHC (p) Antibodies (anti-human)
- 4 IHC Antibodies (anti-human)
- 2 IF Antibodies (anti-human)
- 1 FACS Antibody (anti-human)
- 65 WB Antibodies (anti-mouse)
- 12 IF (p) Antibodies (anti-mouse)
- 5 FACS Antibodies (anti-mouse)
- 2 IF Antibodies (anti-mouse)
- 31 WB Antibodies (anti-rat)
- 12 IF (p) Antibodies (anti-rat)
- 2 IF Antibodies (anti-rat)
- 1 FACS Antibody (anti-rat)
- antibodies-online: Search results for 28 available TGFBR1 Elisa Kits ranked by validation data
- Compare Top TGFBR1 Elisa Kits
- antibodies-online: Search results for 18 available TGFBR1 Proteins ranked by validation data
- Compare Top TGFBR1 Proteins
- Search GeneTex for Antibodies for TGFBR1
- Search GeneTex for Proteins for TGFBR1
- ViGene Biosciences adenoviral particle packaged cDNA for TGFBR1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for TGFBR1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for TGFBR1 gene
- Search ViGene Biosciences for TGFBR1
- Horizon Cell Lines for TGFBR1
- genomics-online: cdna clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
- orf clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
- genomics-online: gRNA clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
- genomics-online: primer clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
- genomics-online: shRNA clones - Search results for 136 available TGFBR1 gene related products
- Overview of 136 available TGFBR1 gene related products
Sources for TGFBR1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152)