The protein encoded by this gene is a serine/threonine protein kinase that activates the p38/MAPK14 stress-activated MAPK cascade but inhibits the basal activity of the MAPK8/JNK cascade. The encoded protein is a member of the GCK subfamily of STE20-like kinases. [provided by RefSeq, Oct 2016] See more...

Aliases for TAOK3 Gene

Aliases for TAOK3 Gene

  • TAO Kinase 3 2 3 5
  • MAP3K18 2 3 4
  • DPK 2 3 4
  • JIK 2 3 4
  • Cutaneous T-Cell Lymphoma-Associated Antigen HD-CL-09 3 4
  • Dendritic Cell-Derived Protein Kinase 3 4
  • Thousand And One Amino Acid Protein 3 3 4
  • Serine/Threonine-Protein Kinase TAO3 3 4
  • CTCL-Associated Antigen HD-CL-09 3 4
  • Kinase From Chicken Homolog A 3 4
  • Jun Kinase-Inhibitory Kinase 3 4
  • JNK/SAPK-Inhibitory Kinase 3 4
  • EC 2.7.11.1 4 51
  • HKFC-A 3 4
  • STE20-Like Kinase 3
  • EC 2.7.11 51
  • TAOK3 5
  • KDS 4

External Ids for TAOK3 Gene

Previous GeneCards Identifiers for TAOK3 Gene

  • GC12M117050
  • GC12M118587
  • GC12M115597

Summaries for TAOK3 Gene

Entrez Gene Summary for TAOK3 Gene

  • The protein encoded by this gene is a serine/threonine protein kinase that activates the p38/MAPK14 stress-activated MAPK cascade but inhibits the basal activity of the MAPK8/JNK cascade. The encoded protein is a member of the GCK subfamily of STE20-like kinases. [provided by RefSeq, Oct 2016]

GeneCards Summary for TAOK3 Gene

TAOK3 (TAO Kinase 3) is a Protein Coding gene. Diseases associated with TAOK3 include Cutaneous T Cell Lymphoma and Cardiomyopathy, Familial Hypertrophic, 9. Among its related pathways are MAPK signaling pathway and P38 MAPK Signaling Pathway (sino). Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TAOK1.

UniProtKB/Swiss-Prot Summary for TAOK3 Gene

  • Serine/threonine-protein kinase that acts as a regulator of the p38/MAPK14 stress-activated MAPK cascade and of the MAPK8/JNK cascade. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. Inhibits basal activity of MAPK8/JNK cascade and diminishes its activation in response epidermal growth factor (EGF).

Gene Wiki entry for TAOK3 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for TAOK3 Gene

Genomics for TAOK3 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for TAOK3 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH12J118370 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 602.7 -1.2 -1213 8.7 SP1 GATAD2A CTCF ZBTB33 PRDM10 ZNF629 REST RFX1 IKZF1 NFKBIZ SUDS3 TAOK3 lnc-VSIG10-4 RFC5 PEBP1 ENSG00000270482 SRRM4
GH12J118355 Promoter/Enhancer 2.1 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 604.4 +15.2 15240 5.3 CTCF ZNF629 LEF1 ZNF692 ZNF174 DDX20 MTA2 ZNF143 PKNOX1 PATZ1 TAOK3 SUDS3 RFC5 PEBP1 HE856110 lnc-VSIG10-4
GH12J118328 Enhancer 1.1 ENCODE dbSUPER 13.4 +42.3 42336 3.4 ARHGAP35 ZNF512 LEF1 IKZF1 JUND DDX20 MTA2 PKNOX1 MTA1 BRD9 SUDS3 TAOK3 PEBP1 HE856110 lnc-VSIG10-4 RF00017-1299
GH12J118287 Enhancer 1.1 Ensembl ENCODE dbSUPER 12 +84.7 84749 1.6 LEF1 IKZF1 JUND DPF2 HDAC1 SOX6 GATAD2B EP300 SCRT2 THRA SUDS3 TAOK3 SRRM4 ENSG00000213144 RF00017-1299 HE856110 lnc-VSIG10-4 PEBP1
GH12J118311 Enhancer 0.8 ENCODE dbSUPER 13 +59.7 59738 3.2 BACH1 IKZF2 PKNOX1 ARID3A DPF2 RELB BCL11A NBN JUNB SPI1 SUDS3 TAOK3 PEBP1 HE856110 RF00017-1299 lnc-VSIG10-4
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around TAOK3 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for TAOK3

Top Transcription factor binding sites by QIAGEN in the TAOK3 gene promoter:
  • AP-4
  • CBF(2)
  • CBF-A
  • CREB
  • deltaCREB
  • Evi-1
  • Lmo2
  • Pax-2
  • Pax-2a
  • Pax-2b

Genomic Locations for TAOK3 Gene

Genomic Locations for TAOK3 Gene
chr12:118,149,801-118,372,950
(GRCh38/hg38)
Size:
223,150 bases
Orientation:
Minus strand
chr12:118,587,606-118,810,750
(GRCh37/hg19)
Size:
223,145 bases
Orientation:
Minus strand

Genomic View for TAOK3 Gene

Genes around TAOK3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TAOK3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TAOK3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TAOK3 Gene

Proteins for TAOK3 Gene

  • Protein details for TAOK3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H2K8-TAOK3_HUMAN
    Recommended name:
    Serine/threonine-protein kinase TAO3
    Protein Accession:
    Q9H2K8
    Secondary Accessions:
    • Q658N1
    • Q8IUM4
    • Q9HC79
    • Q9NZM9
    • Q9UHG7

    Protein attributes for TAOK3 Gene

    Size:
    898 amino acids
    Molecular mass:
    105406 Da
    Quaternary structure:
    • Self-associates. Interacts with ERN1 and TRAF2. Interaction with TRAF2 is facilitated under ER stress conditions, such as treatment with tunicamycin, and may promote TRAF2 phosphorylation.
    SequenceCaution:
    • Sequence=AAN09723.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for TAOK3 Gene

neXtProt entry for TAOK3 Gene

Selected DME Specific Peptides for TAOK3 Gene

Q9H2K8:
  • DIKAGNIL
  • AAADEKKFQQQILAQQKKD
  • KKMSYSGKQ
  • ELLNAYQSKIK
  • LQHQTEL
  • AQQKKDLT
  • DLIQRTKDAVRELDNLQYRKMKKILFQE
  • DEAQEAECQ
  • QALRLDE
  • LEQRVSL
  • QIKKQFQ
  • NEDHSTPKKEKQERISKHKENLQHTQAEEEA
  • RERFATIKSASLVTRQIHEHEQENELREQMSGYKRMRRQ
  • EIGHGSFGAVYFA
  • RPTQSVQ
  • WSLGITCIELAER
  • VKLADFG
  • ALQKERSERIK
  • LLERQERE
  • EYKGCYL
  • KAGNILL
  • MNAMSALYHIAQN
  • SGYKRMRRQHQKQL
  • HRDIKAGN
  • WMAPEVI
  • EQTRKLAILAEQY
  • DESTRELEYRQL
  • KEAKVAAADE
  • IREELNKKRTQKEMEHAMLIR
  • GTPYWMAPE
  • VLIDLIQRTKDAVRELDNLQYRKMKK
  • NQLEYNKRRE

Post-translational modifications for TAOK3 Gene

  • Autophosphorylated. Phosphorylation at Ser-324 by ATM following DNA damage is required for activation of the p38/MAPK14 stress-activated MAPK cascade. Phosphorylated by LRRK2.
  • Ubiquitination at Lys260 and Lys855
  • Modification sites at PhosphoSitePlus

Domains & Families for TAOK3 Gene

Gene Families for TAOK3 Gene

Protein Domains for TAOK3 Gene

Suggested Antigen Peptide Sequences for TAOK3 Gene

GenScript: Design optimal peptide antigens:
  • Thousand and one amino acid protein 3 (TAOK3_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9H2K8

UniProtKB/Swiss-Prot:

TAOK3_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with TAOK3: view

Function for TAOK3 Gene

Molecular function for TAOK3 Gene

UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase that acts as a regulator of the p38/MAPK14 stress-activated MAPK cascade and of the MAPK8/JNK cascade. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. Inhibits basal activity of MAPK8/JNK cascade and diminishes its activation in response epidermal growth factor (EGF).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.

Enzyme Numbers (IUBMB) for TAOK3 Gene

Phenotypes From GWAS Catalog for TAOK3 Gene

Gene Ontology (GO) - Molecular Function for TAOK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IDA 10559204
GO:0004709 MAP kinase kinase kinase activity IBA --
GO:0004860 protein kinase inhibitor activity TAS 10559204
genes like me logo Genes that share ontologies with TAOK3: view
genes like me logo Genes that share phenotypes with TAOK3: view

Animal Model Products

  • Taconic Biosciences Mouse Models for TAOK3

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK3

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for TAOK3 Gene

Localization for TAOK3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for TAOK3 Gene

Cytoplasm. Cell membrane. Peripheral membrane protein. Note=Also localized to the peripheral cell membrane.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TAOK3 gene
Compartment Confidence
plasma membrane 4
cytosol 4
mitochondrion 3
extracellular 2
cytoskeleton 2
nucleus 2
endoplasmic reticulum 2
endosome 2
peroxisome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for TAOK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IBA 21873635
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with TAOK3: view

Pathways & Interactions for TAOK3 Gene

genes like me logo Genes that share pathways with TAOK3: view

Pathways by source for TAOK3 Gene

1 Sino Biological pathway for TAOK3 Gene
1 BioSystems pathway for TAOK3 Gene
1 KEGG pathway for TAOK3 Gene

SIGNOR curated interactions for TAOK3 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for TAOK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade IMP 10924369
GO:0000186 activation of MAPKK activity IBA --
GO:0006281 DNA repair IEA --
GO:0006468 protein phosphorylation IEA,IMP 11278723
GO:0006469 negative regulation of protein kinase activity IEA --
genes like me logo Genes that share ontologies with TAOK3: view

Drugs & Compounds for TAOK3 Gene

(4) Drugs for TAOK3 Gene - From: DrugBank, PharmGKB, and HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
Morphine Approved, Investigational Pharma Agonist, Full agonist, Partial agonist 1406
ATP Investigational Nutra Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation 0
opioids Pharma 0

(1) Additional Compounds for TAOK3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist 58-64-0
genes like me logo Genes that share compounds with TAOK3: view

Transcripts for TAOK3 Gene

mRNA/cDNA for TAOK3 Gene

12 REFSEQ mRNAs :
17 NCBI additional mRNA sequence :
19 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK3

Alternative Splicing Database (ASD) splice patterns (SP) for TAOK3 Gene

No ASD Table

Relevant External Links for TAOK3 Gene

GeneLoc Exon Structure for
TAOK3

Expression for TAOK3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for TAOK3 Gene

Protein differential expression in normal tissues from HIPED for TAOK3 Gene

This gene is overexpressed in Lymph node (15.2), Peripheral blood mononuclear cells (12.8), and CD8 Tcells (7.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for TAOK3 Gene



Protein tissue co-expression partners for TAOK3 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for TAOK3

SOURCE GeneReport for Unigene cluster for TAOK3 Gene:

Hs.644420

mRNA Expression by UniProt/SwissProt for TAOK3 Gene:

Q9H2K8-TAOK3_HUMAN
Tissue specificity: Ubiquitously expressed at a low level, and highly expressed in peripheral blood leukocytes (PBLs), thymus, spleen, kidney, skeletal muscle, heart and liver.

Evidence on tissue expression from TISSUES for TAOK3 Gene

  • Blood(4.6)
  • Liver(4.5)
  • Spleen(4.5)
  • Lymph node(4.5)
  • Stomach(4.4)
  • Nervous system(4.4)
  • Skin(3.1)
  • Kidney(2.9)
  • Intestine(2.8)
  • Heart(2.7)
  • Lung(2.7)
  • Muscle(2.7)
  • Bone marrow(2.3)
  • Thyroid gland(2.2)
  • Adrenal gland(2.1)
  • Eye(2.1)
genes like me logo Genes that share expression patterns with TAOK3: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for TAOK3 Gene

Orthologs for TAOK3 Gene

This gene was present in the common ancestor of animals.

Orthologs for TAOK3 Gene

Organism Taxonomy Gene Similarity Type Details
Dog
(Canis familiaris)
Mammalia TAOK3 30 31
  • 95.88 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia TAOK3 30 31
  • 95.51 (n)
OneToOne
Chimpanzee
(Pan troglodytes)
Mammalia TAOK3 30 31
  • 95.42 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia TAOK3 31
  • 95 (a)
OneToOne
Mouse
(Mus musculus)
Mammalia Taok3 30 17 31
  • 88.53 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Taok3 30
  • 87.86 (n)
Chicken
(Gallus gallus)
Aves TAOK3 30 31
  • 85.37 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia TAOK3 31
  • 94 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia Str.18944 30
Zebrafish
(Danio rerio)
Actinopterygii taok3a 30 31
  • 74.91 (n)
OneToMany
taok3b 31
  • 70 (a)
OneToMany
Fruit Fly
(Drosophila melanogaster)
Insecta Tao 31
  • 47 (a)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea kin-18 31
  • 36 (a)
OneToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 43 (a)
OneToMany
Species where no ortholog for TAOK3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Platypus (Ornithorhynchus anatinus)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for TAOK3 Gene

ENSEMBL:
Gene Tree for TAOK3 (if available)
TreeFam:
Gene Tree for TAOK3 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for TAOK3: view image

Paralogs for TAOK3 Gene

(41) SIMAP similar genes for TAOK3 Gene using alignment to 13 proteins:

  • TAOK3_HUMAN
  • F5GWV8_HUMAN
  • F5GX96_HUMAN
  • F5GY38_HUMAN
  • F5H005_HUMAN
  • F5H0M3_HUMAN
  • F5H1I2_HUMAN
  • F5H3L7_HUMAN
  • F5H5C7_HUMAN
  • F5H5E0_HUMAN
  • F5H7G4_HUMAN
  • G3V1Q8_HUMAN
  • H0YF68_HUMAN
genes like me logo Genes that share paralogs with TAOK3: view

Variants for TAOK3 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for TAOK3 Gene

SNP ID Clinical significance and condition Chr 12 pos Variation AA Info Type
713477 Benign: not provided 118,152,332(-) G/A SYNONYMOUS_VARIANT
716290 Likely Benign: not provided 118,243,524(-) A/G INTRON_VARIANT
764719 Likely Benign: not provided 118,160,365(-) A/G INTRON_VARIANT
776755 Benign: not provided 118,243,493(-) T/C SYNONYMOUS_VARIANT,FIVE_PRIME_UTR_VARIANT
784674 Likely Benign: not provided 118,181,610(-) G/A INTRON_VARIANT

Additional dbSNP identifiers (rs#s) for TAOK3 Gene

Structural Variations from Database of Genomic Variants (DGV) for TAOK3 Gene

Variant ID Type Subtype PubMed ID
esv1533353 CNV deletion 17803354
esv2662690 CNV deletion 23128226
esv3580497 CNV loss 25503493
esv3581916 CNV gain 25503493
esv3630885 CNV loss 21293372
esv3630886 CNV loss 21293372
esv3630887 CNV loss 21293372
nsv513369 CNV insertion 21212237
nsv524938 CNV gain 19592680
nsv560390 CNV loss 21841781
nsv973125 CNV duplication 23825009

Variation tolerance for TAOK3 Gene

Residual Variation Intolerance Score: 19.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.59; 30.73% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for TAOK3 Gene

Human Gene Mutation Database (HGMD)
TAOK3
SNPedia medical, phenotypic, and genealogical associations of SNPs for
TAOK3

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TAOK3 Gene

Disorders for TAOK3 Gene

MalaCards: The human disease database

(10) MalaCards diseases for TAOK3 Gene - From: DISEASES and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search TAOK3 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for TAOK3

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with TAOK3: view

No data available for UniProtKB/Swiss-Prot and Genatlas for TAOK3 Gene

Publications for TAOK3 Gene

  1. Cloning of DPK, a novel dendritic cell-derived protein kinase activating the ERK1/ERK2 and JNK/SAPK pathways. (PMID: 10924369) Zhang W … Cao X (Biochemical and biophysical research communications 2000) 2 3 4 23
  2. Human JIK, a novel member of the STE20 kinase family that inhibits JNK and is negatively regulated by epidermal growth factor. (PMID: 10559204) Tassi E … Wong WT (The Journal of biological chemistry 1999) 2 3 4 23
  3. Signal transduction protein array analysis links LRRK2 to Ste20 kinases and PKC zeta that modulate neuronal plasticity. (PMID: 20949042) Zach S … Gillardon F (PloS one 2010) 3 4
  4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41
  5. TAO kinases mediate activation of p38 in response to DNA damage. (PMID: 17396146) Raman M … Cobb MH (The EMBO journal 2007) 3 4

Products for TAOK3 Gene

  • Signalway ELISA kits for TAOK3

Sources for TAOK3 Gene