Free for academic non-profit institutions. Other users need a Commercial license
Aliases for TAOK1 Gene
Aliases for TAOK1 Gene
- TAO Kinase 1 2 3 5
- MAP3K16 2 3 4
- MARKK 2 3 4
- PSK2 2 3 4
- Thousand And One Amino Acid Protein Kinase 1 3 4
- Prostate-Derived Sterile 20-Like Kinase 2 3 4
- Serine/Threonine-Protein Kinase TAO1 3 4
- Prostate-Derived STE20-Like Kinase 2 3 4
- Kinase From Chicken Homolog B 3 4
- MARK Kinase 3 4
- EC 2.7.11.1 4 51
- KIAA1361 2 4
External Ids for TAOK1 Gene
- HGNC: 29259
- Entrez Gene: 57551
- Ensembl: ENSG00000160551
- OMIM: 610266
- UniProtKB: Q7L7X3
Previous GeneCards Identifiers for TAOK1 Gene
- GC17P024742
- GC17P027717
- GC17P023926
- GC17P029391
Summaries for TAOK1 Gene
GeneCards Summary for TAOK1 Gene
TAOK1 (TAO Kinase 1) is a Protein Coding gene. Diseases associated with TAOK1 include Autosomal Dominant Non-Syndromic Intellectual Disability and Wilson-Turner X-Linked Mental Retardation Syndrome. Among its related pathways are Signaling by GPCR and Mitotic Prometaphase. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TAOK3.
UniProtKB/Swiss-Prot Summary for TAOK1 Gene
-
Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
Additional gene information for TAOK1 Gene
- HGNC(29259)
- Entrez Gene(57551)
- Ensembl(ENSG00000160551)
- OMIM(610266)
- UniProtKB(Q7L7X3)
- Open Targets Platform(ENSG00000160551)
- Search for TAOK1 at DataMed
- Search for TAOK1 at HumanCyc
No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for TAOK1 Gene
Genomics for TAOK1 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for TAOK1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around TAOK1 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for TAOK1
- Top Transcription factor binding sites by QIAGEN in the TAOK1 gene promoter:
-
- AhR
- AP-1
- ATF-2
- Bach2
- c-Jun
- COMP1
- ITF-2
- RREB-1
- SEF-1 (1)
- Tal-1beta
Genomic Locations for TAOK1 Gene
Genomic Locations for TAOK1 Gene
- chr17:29,390,363-29,551,904
- (GRCh38/hg38)
- Size:
- 161,542 bases
- Orientation:
- Plus strand
- chr17:27,717,482-27,878,922
- (GRCh37/hg19)
- Size:
- 161,441 bases
- Orientation:
- Plus strand
Genomic View for TAOK1 Gene
Genes around TAOK1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 17q11.2 by HGNC
- 17q11.2 by Entrez Gene
- 17q11.2 by Ensembl
TAOK1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for TAOK1 Gene
Proteins for TAOK1 Gene
-
Protein details for TAOK1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q7L7X3-TAOK1_HUMAN
- Recommended name:
- Serine/threonine-protein kinase TAO1
- Protein Accession:
- Q7L7X3
- A2RUT8
- B7ZLV6
- Q96L75
- Q9H2K7
- Q9H7S5
- Q9P2I6
Protein attributes for TAOK1 Gene
- Size:
- 1001 amino acids
- Molecular mass:
- 116070 Da
- Quaternary structure:
-
- Self-associates. Interacts with MAP2K3 (By similarity). Interacts with SPRED1 and TESK1. Interacts with MAP3K7.
- SequenceCaution:
-
- Sequence=BAA92599.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};
Protein Expression for TAOK1 Gene
Selected DME Specific Peptides for TAOK1 Gene
- Q7L7X3:
-
- DIKAGNIL
- KKMSYSGKQ
- ELLNAYQSKIK
- LQHQTEL
- LENKLKAEMDEHRLRLDKDLETQRNNF
- DEAQEAECQ
- QALRLDE
- LEQRVSL
- THGALQGLAYLHSH
- WSHNPTGG
- TCKIQTRQYKALR
- QIKKQFQ
- QEHEQDS
- FVLRERP
- EIGHGSFGAVYFA
- LECRRFKRRMLL
- ENQSTPK
- YDGKVDV
- EKWQDIIKEV
- WSLGITCIELAER
- RKEQLKEEL
- VKLADFG
- QTQKDLE
- QELEFRHL
- EYKGCYL
- KAGNILL
- ERIRSLLERQAREIEAFD
- ERELRRK
- SPPQVSRHKSHYRNREHFATIRTASLVTRQ
- MNAMSALYHIAQN
- SGYKRMRRQHQKQL
- HRDIKAGN
- WMAPEVI
- QHFQAEEEANLLRRQRQYL
- SRSTSVTSQ
- EQTRKLAILAEQY
- SDDKSELDMMEGDHTVMSNSSVIHLKPEEENY
- LKDPEIAELFFKEDPE
- IEEEMLALQ
- EWSDYFRNFVDSCL
- HLLETTPK
- GSNQSIPSMSISASSQSSSV
- EKKFQQHIQAQQKKELN
- GTPYWMAPE
- VLIDLIQRTKDAVRELDNLQYRKMKK
- NQLEYNKRRE
Post-translational modifications for TAOK1 Gene
- Proteolytically processed by caspase-3 (CASP3).
- Autophosphorylated (By similarity). Phosphorylated by ATM in response to DNA damage. Phosphorylated by LRRK2.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for TAOK1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- G Biosciences Immunotag™ TAOK1 Antibody
-
Custom Antibody ServicesOriGene Antibodies for TAOK1
- Novus Biologicals Antibodies for TAOK1
-
Abcam antibodies for TAOK1
- Invitrogen Antibodies for TAOK1 (AFLGC-TAOK1)
-
Boster Bio Antibodies for TAOK1
-
Santa Cruz Biotechnology (SCBT) Antibodies for TAOK1
Protein Products
-
OriGene Purified Proteins for TAOK1
- Search Origene for MassSpec and Protein Over-expression Lysates for TAOK1
- Origene Custom Protein Services for TAOK1
- antibodies-online: Show 5 available TAOK1 Proteins ranked by validation data
- Compare Top TAOK1 Proteins
-
Quality Products:
-
Signalway Proteins for TAOK1
-
Abcam proteins for TAOK1
Assay Products
- antibodies-online: Show 6 available TAOK1 Elisa Kits ranked by validation data
- Compare Top TAOK1 Elisa Kits
-
Quality Products:
-
Signalway ELISA kits for TAOK1
Domains & Families for TAOK1 Gene
Gene Families for TAOK1 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for TAOK1 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for TAOK1 Gene
- GenScript: Design optimal peptide antigens:
-
- Thousand and one amino acid protein 1 (TAOK1_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q7L7X3UniProtKB/Swiss-Prot:
TAOK1_HUMAN :- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Function for TAOK1 Gene
Molecular function for TAOK1 Gene
- UniProtKB/Swiss-Prot Function:
- Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.
- UniProtKB/Swiss-Prot Induction:
- In response to DNA damage.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Serine/threonine-protein kinase activity is inhibited by SPRED1.
Enzyme Numbers (IUBMB) for TAOK1 Gene
Phenotypes From GWAS Catalog for TAOK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0004672 | protein kinase activity | ISS,NAS | 14517247 |
| GO:0004674 | protein serine/threonine kinase activity | NAS | 14517247 |
| GO:0004709 | MAP kinase kinase kinase activity | IBA | -- |
| GO:0005515 | protein binding | IPI | 11733138 |
Phenotypes for TAOK1 Gene
- GenomeRNAi human phenotypes for TAOK1:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Synthetic lethal with Ras
- Increased endosome-nucleus distance (endosomes dispersed in the cell periphery)
- Weakly decreased NFAT1-GFP nuclear translocation
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, increased cell elongation
- Decreased viability
- Increased shRNA abundance (Z-score > 2)
- Decreased homologous recombination repair frequency
- Decreased shRNA abundance (Z-score < -2)
- Decreased p24 protein expression
- Decreased Tat-dependent transcription
- Decreased substrate adherent cell growth
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Reduced beta-catenin activity and colon cancer cell proliferation
Animal Model Products
-
Taconic Biosciences Mouse Models for TAOK1
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for TAOK1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for TAOK1
-
Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
miRNA for TAOK1 Gene
- miRTarBase miRNAs that target TAOK1
-
- mmu-miR-183-5p (MIRT007110)
- mmu-miR-301b-3p (MIRT008068)
- mmu-miR-425-5p (MIRT008807)
- mmu-miR-362-5p (MIRT009051)
- mmu-miR-17-5p (MIRT010140)
- mmu-miR-26a-5p (MIRT011476)
- mmu-miR-34b-5p (MIRT012913)
- mmu-miR-297a-5p (MIRT013099)
- mmu-miR-181a-5p (MIRT014417)
- hsa-miR-425-5p (MIRT016671)
- hsa-miR-142-3p (MIRT021639)
- hsa-miR-30b-5p (MIRT023458)
- hsa-miR-96-5p (MIRT027919)
- hsa-miR-190a-3p (MIRT116236)
- hsa-miR-297 (MIRT116239)
- hsa-miR-466 (MIRT116240)
- hsa-miR-3941 (MIRT116241)
- hsa-miR-4643 (MIRT116242)
- hsa-miR-4789-3p (MIRT116244)
- hsa-miR-5011-5p (MIRT116245)
- hsa-miR-6867-5p (MIRT116247)
- hsa-miR-8485 (MIRT116248)
- hsa-miR-124-5p (MIRT196428)
- hsa-miR-490-5p (MIRT196429)
- hsa-miR-1206 (MIRT196430)
- hsa-miR-1246 (MIRT196431)
- hsa-miR-27a-3p (MIRT196434)
- hsa-miR-27b-3p (MIRT196436)
- hsa-miR-144-5p (MIRT196437)
- hsa-miR-144-3p (MIRT196438)
- hsa-miR-1255a (MIRT196440)
- hsa-miR-1255b-5p (MIRT196441)
- hsa-miR-15a-5p (MIRT196450)
- hsa-miR-16-5p (MIRT196451)
- hsa-miR-15b-5p (MIRT196453)
- hsa-miR-195-5p (MIRT196455)
- hsa-miR-424-5p (MIRT196457)
- hsa-miR-497-5p (MIRT196458)
- hsa-miR-503-5p (MIRT196459)
- hsa-miR-646 (MIRT196460)
- hsa-miR-6838-5p (MIRT196467)
- hsa-miR-3908 (MIRT196474)
- hsa-miR-541-5p (MIRT196478)
- hsa-miR-374b-3p (MIRT196479)
- hsa-miR-4524a-5p (MIRT196480)
- hsa-miR-4524b-5p (MIRT196481)
- hsa-miR-4533 (MIRT196503)
- hsa-miR-3177-5p (MIRT196528)
- hsa-miR-7856-5p (MIRT196560)
- hsa-miR-18a-5p (MIRT196599)
- hsa-miR-24-3p (MIRT196600)
- hsa-miR-18b-5p (MIRT196601)
- hsa-miR-3190-3p (MIRT196602)
- hsa-miR-3202 (MIRT196603)
- hsa-miR-3677-5p (MIRT196604)
- hsa-miR-4735-3p (MIRT196606)
- hsa-miR-4795-5p (MIRT196607)
- hsa-miR-5585-3p (MIRT196608)
- hsa-miR-130a-3p (MIRT196620)
- hsa-miR-301a-3p (MIRT196621)
- hsa-miR-130b-3p (MIRT196622)
- hsa-miR-519c-3p (MIRT196623)
- hsa-miR-519b-3p (MIRT196624)
- hsa-miR-519a-3p (MIRT196625)
- hsa-miR-454-3p (MIRT196627)
- hsa-miR-301b-3p (MIRT196629)
- hsa-miR-1229-5p (MIRT196630)
- hsa-miR-4295 (MIRT196631)
- hsa-miR-3658 (MIRT196632)
- hsa-miR-3666 (MIRT196633)
- hsa-miR-4476 (MIRT196634)
- hsa-miR-6756-5p (MIRT196635)
- hsa-miR-6766-5p (MIRT196636)
- hsa-miR-6769a-5p (MIRT196637)
- hsa-miR-6769b-5p (MIRT196638)
- hsa-miR-6876-5p (MIRT196639)
- hsa-miR-8065 (MIRT196640)
- hsa-miR-2392 (MIRT196679)
- hsa-miR-4320 (MIRT286461)
- hsa-miR-3653-3p (MIRT286464)
- hsa-miR-2355-5p (MIRT286477)
- hsa-miR-625-5p (MIRT286483)
- hsa-miR-4284 (MIRT286500)
- hsa-miR-6504-3p (MIRT286505)
- hsa-miR-125a-3p (MIRT344615)
- hsa-miR-764 (MIRT344616)
- hsa-miR-3934-5p (MIRT344619)
- hsa-miR-1262 (MIRT344635)
- hsa-miR-4701-3p (MIRT344639)
- hsa-miR-6736-5p (MIRT344641)
- hsa-miR-27b-5p (MIRT386735)
- hsa-miR-3133 (MIRT386753)
- hsa-miR-4511 (MIRT386754)
- hsa-miR-511-3p (MIRT386755)
- hsa-miR-548at-5p (MIRT386758)
- hsa-miR-4477b (MIRT395279)
- hsa-miR-4684-5p (MIRT466624)
- hsa-miR-3165 (MIRT466625)
- hsa-miR-6880-5p (MIRT466626)
- hsa-miR-8071 (MIRT466627)
- hsa-miR-138-1-3p (MIRT466628)
- hsa-miR-1244 (MIRT466629)
- hsa-miR-5692c (MIRT466630)
- hsa-miR-5692b (MIRT466631)
- hsa-miR-1265 (MIRT466632)
- hsa-miR-128-3p (MIRT466633)
- hsa-miR-3681-3p (MIRT466634)
- hsa-miR-216a-3p (MIRT466635)
- hsa-miR-7641 (MIRT466636)
- hsa-miR-4662a-5p (MIRT466637)
- hsa-miR-876-5p (MIRT466638)
- hsa-miR-3167 (MIRT466639)
- hsa-miR-6768-3p (MIRT466640)
- hsa-miR-6741-5p (MIRT492087)
- hsa-miR-4483 (MIRT492088)
- hsa-miR-1293 (MIRT492089)
- hsa-miR-6745 (MIRT492090)
- hsa-miR-363-5p (MIRT492091)
- hsa-miR-3132 (MIRT492092)
- hsa-miR-197-5p (MIRT492093)
- hsa-miR-9-5p (MIRT492094)
- hsa-miR-3679-3p (MIRT492095)
- hsa-miR-3145-3p (MIRT492096)
- hsa-miR-4286 (MIRT492097)
- hsa-miR-181a-2-3p (MIRT492098)
- hsa-miR-892c-5p (MIRT492099)
- hsa-miR-580-5p (MIRT498040)
- hsa-miR-561-3p (MIRT498041)
- hsa-miR-5089-5p (MIRT520801)
- hsa-miR-6807-5p (MIRT520802)
- hsa-miR-7151-3p (MIRT520803)
- hsa-miR-5095 (MIRT520804)
- hsa-miR-5589-5p (MIRT520805)
- hsa-miR-4731-5p (MIRT520806)
- hsa-miR-6506-5p (MIRT520807)
- hsa-miR-619-5p (MIRT520808)
- hsa-miR-6884-3p (MIRT520809)
- hsa-miR-512-3p (MIRT520810)
- hsa-miR-552-3p (MIRT520811)
- hsa-miR-372-3p (MIRT520812)
- hsa-miR-373-3p (MIRT520813)
- hsa-miR-520b (MIRT520814)
- hsa-miR-520c-3p (MIRT520815)
- hsa-miR-520d-3p (MIRT520816)
- hsa-miR-302d-3p (MIRT520817)
- hsa-miR-520e (MIRT520818)
- hsa-miR-302c-3p (MIRT520819)
- hsa-miR-302b-3p (MIRT520820)
- hsa-miR-302e (MIRT520821)
- hsa-miR-302a-3p (MIRT520822)
- hsa-miR-520a-3p (MIRT520823)
- hsa-miR-1290 (MIRT540745)
- hsa-miR-223-5p (MIRT542648)
- hsa-miR-567 (MIRT542649)
- hsa-miR-603 (MIRT546349)
- hsa-miR-362-3p (MIRT546350)
- hsa-miR-329-3p (MIRT546351)
- hsa-miR-525-5p (MIRT553758)
- hsa-miR-520a-5p (MIRT553759)
- hsa-miR-549a (MIRT553760)
- hsa-miR-676-5p (MIRT553761)
- hsa-miR-4661-3p (MIRT553762)
- hsa-miR-1303 (MIRT621883)
- hsa-miR-5096 (MIRT621884)
- hsa-miR-197-3p (MIRT621885)
- hsa-miR-411-5p (MIRT621886)
- hsa-miR-6832-5p (MIRT621887)
- hsa-miR-193b-5p (MIRT621888)
- hsa-miR-483-5p (MIRT621889)
- hsa-miR-6894-3p (MIRT638190)
- hsa-miR-5001-3p (MIRT638191)
- hsa-miR-378a-5p (MIRT638192)
- hsa-miR-4763-5p (MIRT638193)
- hsa-miR-6778-3p (MIRT638194)
- hsa-miR-6821-3p (MIRT638195)
- hsa-miR-6790-3p (MIRT638196)
- hsa-miR-3653-5p (MIRT638197)
- hsa-miR-6747-3p (MIRT638198)
- hsa-miR-4777-5p (MIRT641844)
- hsa-miR-523-5p (MIRT641845)
- hsa-miR-526a (MIRT641846)
- hsa-miR-522-5p (MIRT641847)
- hsa-miR-520c-5p (MIRT641848)
- hsa-miR-519c-5p (MIRT641849)
- hsa-miR-519b-5p (MIRT641850)
- hsa-miR-519a-5p (MIRT641851)
- hsa-miR-518f-5p (MIRT641852)
- hsa-miR-518e-5p (MIRT641853)
- hsa-miR-518d-5p (MIRT641854)
- hsa-miR-6837-3p (MIRT641855)
- hsa-miR-4305 (MIRT641856)
- hsa-miR-6787-3p (MIRT641857)
- hsa-miR-578 (MIRT652818)
- hsa-miR-4753-3p (MIRT652819)
- hsa-miR-6892-5p (MIRT652820)
- hsa-miR-4793-5p (MIRT652821)
- hsa-miR-5196-3p (MIRT652822)
- hsa-miR-501-5p (MIRT652823)
- hsa-miR-6856-3p (MIRT652824)
- hsa-miR-4475 (MIRT652825)
- hsa-miR-640 (MIRT665950)
- hsa-miR-6853-3p (MIRT683185)
- hsa-miR-1277-5p (MIRT707849)
- hsa-miR-4665-5p (MIRT712137)
- hsa-miR-1275 (MIRT712138)
- hsa-miR-588 (MIRT712139)
- hsa-miR-4701-5p (MIRT712140)
- hsa-miR-5010-5p (MIRT712141)
- hsa-miR-4525 (MIRT712142)
- hsa-miR-7111-5p (MIRT712143)
- hsa-miR-6870-5p (MIRT712144)
- hsa-miR-5698 (MIRT712145)
- hsa-miR-4723-5p (MIRT712146)
- hsa-miR-3175 (MIRT712147)
- hsa-miR-8085 (MIRT712148)
- hsa-miR-6731-5p (MIRT712149)
- hsa-miR-4644 (MIRT712150)
- hsa-miR-4306 (MIRT712151)
- hsa-miR-185-5p (MIRT712152)
- hsa-miR-7106-3p (MIRT712153)
- hsa-miR-4252 (MIRT712154)
- hsa-miR-2467-5p (MIRT712155)
- hsa-miR-637 (MIRT712156)
- hsa-miR-3162-3p (MIRT712157)
- hsa-miR-6856-5p (MIRT712158)
- hsa-miR-6758-5p (MIRT712159)
- hsa-miR-942-3p (MIRT712160)
- hsa-miR-30e-5p (MIRT726386)
- hsa-miR-30d-5p (MIRT726387)
- hsa-miR-30c-5p (MIRT726388)
- hsa-miR-30a-5p (MIRT726389)
- hsa-miR-1289 (MIRT783413)
- hsa-miR-129-5p (MIRT783608)
- hsa-miR-3672 (MIRT785163)
- hsa-miR-6864-3p (MIRT789168)
- hsa-miR-8055 (MIRT789738)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK1
Clone Products
- Applied Biological Materials (abm): Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for TAOK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for TAOK1
Cell Line Products
-
Horizon Cell Lines for TAOK1
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for TAOK1 Gene
Localization for TAOK1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for TAOK1 Gene
- Cytoplasm.
| Compartment | Confidence |
|---|---|
| cytosol | 5 |
| extracellular | 4 |
| cytoskeleton | 4 |
| nucleus | 3 |
| plasma membrane | 1 |
| mitochondrion | 1 |
| endoplasmic reticulum | 1 |
| endosome | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Vesicles (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005623 | cell | IEA | -- |
| GO:0005737 | cytoplasm | IBA | 21873635 |
| GO:0005829 | cytosol | TAS | -- |
| GO:0015630 | microtubule cytoskeleton | IMP | 12639963 |
| GO:0048471 | perinuclear region of cytoplasm | IMP | 12639963 |
Pathways & Interactions for TAOK1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Cell Cycle, Mitotic |
.83
|
.60
|
| 2 | Mitotic Metaphase and Anaphase |
.94
|
|
| 3 | Mitotic Prometaphase | ||
| 4 | MAPK signaling pathway | ||
| 5 | Signaling by Rho GTPases | ||
Pathways by source for TAOK1 Gene
1 Sino Biological pathway for TAOK1 Gene
2 BioSystems pathways for TAOK1 Gene
12 Reactome pathways for TAOK1 Gene
1 KEGG pathway for TAOK1 Gene
Interacting Proteins for TAOK1 Gene
Selected Interacting proteins:
Q7L7X3-TAOK1_HUMAN
ENSP00000261716
for TAOK1 Gene via
MINT
STRING
IID
GPS-Prot Interaction Network for TAOK1
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000186 | activation of MAPKK activity | IBA | -- |
| GO:0000187 | activation of MAPK activity | TAS | 22683681 |
| GO:0000226 | microtubule cytoskeleton organization | IMP | 12639963 |
| GO:0006281 | DNA repair | IEA | -- |
| GO:0006468 | protein phosphorylation | NAS | 14517247 |
Drugs & Compounds for TAOK1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist | 58-64-0 |
|
Transcripts for TAOK1 Gene
mRNA/cDNA for TAOK1 Gene
- 2 REFSEQ mRNAs :
- 19 NCBI additional mRNA sequence :
- 6 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000261716 12407 nts (view in UCSC)
- ENST00000536202 4068 nts (view in UCSC)
- ENST00000577583 5557 nts (view in UCSC)
- ENST00000578653 564 nts (view in UCSC)
- ENST00000583121 526 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for TAOK1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for TAOK1
-
Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK1
Clone Products
- Applied Biological Materials (abm): Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for TAOK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for TAOK1
| ExUns: | 1 | ^ | 2a | · | 2b | ^ | 3 | ^ | 4a | · | 4b | · | 4c | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9a | · | 9b | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19 | ^ | 20 | ^ | 21 | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - |
| ExUns: | 22 |
|---|---|
| SP1: | |
| SP2: | |
| SP3: | |
| SP4: |
Relevant External Links for TAOK1 Gene
- GeneLoc Exon Structure for
- TAOK1
Expression for TAOK1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Blood (Hematopoietic System)
- Proerythroblasts Hematopoietic Bone Marrow
- pre Conventional Dendritic Cells Peripheral Blood
- Double Positive Thymocytes Thymus
-
Thymus (Hematopoietic System)
- Double Positive Thymocytes Thymus
- Eye (Sensory Organs)
This gene is overexpressed in Peripheral blood mononuclear cells (35.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for TAOK1 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for TAOK1
SOURCE GeneReport for Unigene cluster for TAOK1 Gene:
Hs.597434mRNA Expression by UniProt/SwissProt for TAOK1 Gene:
Q7L7X3-TAOK1_HUMAN
Tissue specificity:
Highly expressed in the testis, and to a lower extent also expressed in brain, placenta, colon and skeletal muscle.
Evidence on tissue expression from TISSUES for TAOK1 Gene
- Nervous system(4.9)
- Blood(4.5)
- Liver(4.5)
- Lung(2.9)
- Heart(2.5)
- Kidney(2.5)
- Intestine(2.5)
- Muscle(2.4)
- Skin(2.3)
- Spleen(2.3)
Primer Products
-
OriGene qPCR primer pairs for TAOK1
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for TAOK1 Gene
Orthologs for TAOK1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | TAOK1 30 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | TAOK1 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | TAOK1 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | TAOK1 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | TAOK1 30 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Taok1 30 |
|
||
| Mouse (Mus musculus) |
Mammalia | Taok1 30 17 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | TAOK1 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | TAOK1 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | taok1 30 |
|
||
| Str.6620 30 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | MGC52943 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | TAOK1 (2 of 3) 31 |
|
OneToMany | |
| taok1 31 |
|
OneToMany | |||
| CU929119.2 31 |
|
OneToMany | |||
| LOC100004576 30 |
|
||||
| Fruit Fly (Drosophila melanogaster) |
Insecta | Tao 30 31 |
|
OneToMany | |
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP003202 30 |
|
||
| Worm (Caenorhabditis elegans) |
Secernentea | kin-18 30 31 |
|
OneToMany | |
| Sea Squirt (Ciona savignyi) |
Ascidiacea | -- 31 |
|
OneToMany | |
| Sea Vase (Ciona intestinalis) |
Ascidiacea | Cin.8830 30 |
|
- Species where no ortholog for TAOK1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for TAOK1 Gene
- ENSEMBL:
- Gene Tree for TAOK1 (if available)
- TreeFam:
- Gene Tree for TAOK1 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for TAOK1: view image
Paralogs for TAOK1 Gene
Paralogs for TAOK1 Gene
(8) SIMAP similar genes for TAOK1 Gene using alignment to 2 proteins:
- TAOK1_HUMAN
- J3QS76_HUMAN
Variants for TAOK1 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for TAOK1 Gene
| SNP ID | Clinical significance and condition | Chr 17 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 717510 | Benign: not provided | 29,498,311(+) | C/T | INTRON_VARIANT | |
| 743113 | Benign: not provided | 29,534,252(+) | C/T | SYNONYMOUS_VARIANT | |
| 777157 | Benign: not provided | 29,489,668(+) | A/G | SYNONYMOUS_VARIANT | |
| 779365 | Benign: not provided | 29,517,575(+) | A/G | SYNONYMOUS_VARIANT,INTRON_VARIANT | |
| 871002 | Uncertain Significance: not provided | 29,530,518(+) | A/G | MISSENSE_VARIANT |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv22895 | CNV | loss | 19812545 |
| esv2335781 | CNV | deletion | 18987734 |
| esv2474903 | CNV | deletion | 19546169 |
| esv2658989 | CNV | deletion | 23128226 |
| esv2673792 | CNV | deletion | 23128226 |
| esv2715797 | CNV | deletion | 23290073 |
| esv3303028 | CNV | tandem duplication | 20981092 |
| esv3405501 | CNV | insertion | 20981092 |
| esv3582597 | CNV | loss | 25503493 |
| esv3640327 | CNV | loss | 21293372 |
| esv994280 | OTHER | inversion | 20482838 |
| nsv1077840 | CNV | duplication | 25765185 |
| nsv819892 | CNV | loss | 19587683 |
| nsv821292 | CNV | duplication | 20802225 |
| nsv827940 | CNV | gain | 20364138 |
| nsv833409 | CNV | gain | 17160897 |
Residual Variation Intolerance Score:
4.52% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.48;
28.86% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for TAOK1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- TAOK1
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TAOK1 Gene
Disorders for TAOK1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| autosomal dominant non-syndromic intellectual disability |
|
|
| wilson-turner x-linked mental retardation syndrome |
|
|
| syndromic x-linked intellectual disability |
|
|
| syndromic intellectual disability |
|
|
Search TAOK1 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for TAOK1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for TAOK1 Gene
Publications for TAOK1 Gene
- Human TAO kinase 1 induces apoptosis in SH-SY5Y cells. (PMID: 17900936) Wu MF … Wang SG (Cell biology international 2008) 3 4 23
- A functional genomic screen identifies a role for TAO1 kinase in spindle-checkpoint signalling. (PMID: 17417629) Draviam VM … Elledge SJ (Nature cell biology 2007) 3 4 23
- MARKK, a Ste20-like kinase, activates the polarity-inducing kinase MARK/PAR-1. (PMID: 14517247) Timm T … Mandelkow EM (The EMBO journal 2003) 2 3 23
- Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10718198) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2000) 2 3 4
- New gene functions in megakaryopoiesis and platelet formation. (PMID: 22139419) Gieger C … Soranzo N (Nature 2011) 3 41
ExternalLinks
Products for TAOK1 Gene
- Custom Antibody ServicesOriGene Antibodies for TAOK1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for TAOK1
- Search Origene for MassSpec and Protein Over-expression Lysates for TAOK1
- Origene Custom Protein Services for TAOK1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- OriGene qPCR primer pairs for TAOK1
- OriGene CRISPR knockouts for TAOK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For TAOK1
- Sino Biological Human cDNA Clone for TAOK1
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for TAOK1
- Novus Biologicals proteins and lysates for TAOK1
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for TAOK1
- Abcam proteins for TAOK1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for TAOK1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for TAOK1 (AFLGC-TAOK1)
- VectorBuilder Custom and pre-made DNA vectors for TAOK1 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for TAOK1 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for TAOK1 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for TAOK1 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for TAOK1
- antibodies-online: Show 23 available TAOK1 Antibodies ranked by validation data
- Compare Top TAOK1 Antibodies
- antibodies-online: Show 6 available TAOK1 Elisa Kits ranked by validation data
- Compare Top TAOK1 Elisa Kits
- Quality Products:
- antibodies-online: Show 5 available TAOK1 Proteins ranked by validation data
- Compare Top TAOK1 Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for TAOK1
- Search Santa Cruz Biotechnology (SCBT) for TAOK1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
- Horizon Cell Lines for TAOK1
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for TAOK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for TAOK1
- Search GeneCopoeia for miRNA 3'UTR Target clone products for TAOK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK1
- Boster Bio Antibodies for TAOK1
- Browse Boster Bio ELISA Kits
Sources for TAOK1 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB