Aliases for TAOK1 Gene
Aliases for TAOK1 Gene
External Ids for TAOK1 Gene
- HGNC: 29259
- Entrez Gene: 57551
- Ensembl: ENSG00000160551
- OMIM: 610266
- UniProtKB: Q7L7X3
Previous GeneCards Identifiers for TAOK1 Gene
- GC17P024742
- GC17P027717
- GC17P023926
Summaries for TAOK1 Gene
GeneCards Summary for TAOK1 Gene
TAOK1 (TAO Kinase 1) is a Protein Coding gene. Among its related pathways are Cell Cycle, Mitotic and p38 MAPK signaling pathway (Pathway Interaction Database). Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TAOK3.
UniProtKB/Swiss-Prot Summary for TAOK1 Gene
-
Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for TAOK1 Gene
Genomics for TAOK1 Gene
GeneHancer (GH) Regulatory Elements for TAOK1 Gene
Promoters and enhancers for TAOK1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around TAOK1 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the TAOK1 gene promoter:
-
- AhR
- AP-1
- ATF-2
- Bach2
- c-Jun
- COMP1
- ITF-2
- RREB-1
- SEF-1 (1)
- Tal-1beta
Genomic Locations for TAOK1 Gene
Genomic Locations for TAOK1 Gene
- chr17:29,390,464-29,551,904
- (GRCh38/hg38)
- Size:
- 161,441 bases
- Orientation:
- Plus strand
- chr17:27,717,482-27,878,922
- (GRCh37/hg19)
- Size:
- 161,441 bases
- Orientation:
- Plus strand
Genomic View for TAOK1 Gene
Genes around TAOK1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 17q11.2 by HGNC
- 17q11.2 by Entrez Gene
- 17q11.2 by Ensembl
TAOK1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for TAOK1 Gene
Proteins for TAOK1 Gene
-
Protein details for TAOK1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q7L7X3-TAOK1_HUMAN
- Recommended name:
- Serine/threonine-protein kinase TAO1
- Protein Accession:
- Q7L7X3
- A2RUT8
- B7ZLV6
- Q96L75
- Q9H2K7
- Q9H7S5
- Q9P2I6
Protein attributes for TAOK1 Gene
- Size:
- 1001 amino acids
- Molecular mass:
- 116070 Da
- Quaternary structure:
-
- Self-associates. Interacts with MAP2K3 (By similarity). Interacts with SPRED1 and TESK1. Interacts with MAP3K7.
- SequenceCaution:
-
- Sequence=BAA92599.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Protein Expression for TAOK1 Gene
Selected DME Specific Peptides for TAOK1 Gene
- Q7L7X3:
-
- DIKAGNIL
- KKMSYSGKQ
- ELLNAYQSKIK
- LQHQTEL
- LENKLKAEMDEHRLRLDKDLETQRNNF
- DEAQEAECQ
- QALRLDE
- LEQRVSL
- THGALQGLAYLHSH
- WSHNPTGG
- TCKIQTRQYKALR
- QIKKQFQ
- QEHEQDS
- FVLRERP
- EIGHGSFGAVYFA
- LECRRFKRRMLL
- ENQSTPK
- YDGKVDV
- EKWQDIIKEV
- WSLGITCIELAER
- RKEQLKEEL
- VKLADFG
- QTQKDLE
- QELEFRHL
- EYKGCYL
- KAGNILL
- ERIRSLLERQAREIEAFD
- ERELRRK
- SPPQVSRHKSHYRNREHFATIRTASLVTRQ
- MNAMSALYHIAQN
- SGYKRMRRQHQKQL
- HRDIKAGN
- WMAPEVI
- QHFQAEEEANLLRRQRQYL
- SRSTSVTSQ
- EQTRKLAILAEQY
- SDDKSELDMMEGDHTVMSNSSVIHLKPEEENY
- LKDPEIAELFFKEDPE
- IEEEMLALQ
- EWSDYFRNFVDSCL
- HLLETTPK
- GSNQSIPSMSISASSQSSSV
- EKKFQQHIQAQQKKELN
- GTPYWMAPE
- VLIDLIQRTKDAVRELDNLQYRKMKK
- NQLEYNKRRE
Post-translational modifications for TAOK1 Gene
- Proteolytically processed by caspase-3 (CASP3).
- Autophosphorylated (By similarity). Phosphorylated by ATM in response to DNA damage. Phosphorylated by LRRK2.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for TAOK1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- G Biosciences Immunotag™ TAOK1 Antibody
- Atlas Antibodies Anti-TAOK1 Antibody
-
Custom Antibody ServicesOriGene Antibodies for TAOK1
- Novus Biologicals Antibodies for TAOK1
-
Abcam antibodies for TAOK1
- Invitrogen Antibodies for TAOK1 (AFLGC-TAOK1)
-
Boster Bio Antibodies for TAOK1
-
Santa Cruz Biotechnology (SCBT) Antibodies for TAOK1
Protein Products
- Atlas Antibodies PrEST Antigen TAOK1
-
OriGene Purified Proteins for TAOK1
- Search Origene for MassSpec and Protein Over-expression Lysates for TAOK1
- Origene Custom Protein Services for TAOK1
- antibodies-online: Show 5 available TAOK1 Proteins ranked by validation data
- Compare Top TAOK1 Proteins
-
Quality Products:
-
Abcam proteins for TAOK1
Assay Products
- antibodies-online: Show 6 available TAOK1 Elisa Kits ranked by validation data
- Compare Top TAOK1 Elisa Kits
-
Quality Products:
Domains & Families for TAOK1 Gene
Gene Families for TAOK1 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for TAOK1 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for TAOK1 Gene
- GenScript: Design optimal peptide antigens:
-
- Thousand and one amino acid protein 1 (TAOK1_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q7L7X3UniProtKB/Swiss-Prot:
TAOK1_HUMAN :- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Function for TAOK1 Gene
Molecular function for TAOK1 Gene
- UniProtKB/Swiss-Prot Function:
- Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Serine/threonine-protein kinase activity is inhibited by SPRED1.
- UniProtKB/Swiss-Prot Induction:
- In response to DNA damage.
Enzyme Numbers (IUBMB) for TAOK1 Gene
Phenotypes From GWAS Catalog for TAOK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004672 | protein kinase activity | NAS,ISS | 14517247 |
| GO:0004674 | protein serine/threonine kinase activity | NAS | 14517247 |
| GO:0004709 | MAP kinase kinase kinase activity | IBA | 21873635 |
| GO:0005515 | protein binding | IPI | 11733138 |
| GO:0005524 | ATP binding | NAS | 14517247 |
Phenotypes for TAOK1 Gene
- GenomeRNAi human phenotypes for TAOK1:
-
- Decreased substrate adherent cell growth
- Decreased shRNA abundance (Z-score < -2)
- Strongly decreased NFAT1-GFP nuclear translocation
- Increased shRNA abundance (Z-score > 2)
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, increased FA abundance
- Increased homologous recombination repair frequency
- Decreased p24 protein expression
- Decreased Tat-dependent transcription
- Reduced beta-catenin activity and colon cancer cell proliferation
- Increased human cytomegalovirus (HCMV) strain AD169 replication
- Increased vaccinia virus (VACV) infection
- Synthetic lethal with Ras
- Decreased viability
- shRNA abundance <= 50%
- Increased transferrin (TF) endocytosis
Animal Model Products
-
Taconic Biosciences Mouse Models for TAOK1
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * TAOK1 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
OriGene CRISPR knockouts for TAOK1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for TAOK1
- genomics-online: gRNA clones - Search results for available TAOK1 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
miRNA for TAOK1 Gene
- miRTarBase miRNAs that target TAOK1
-
- hsa-mir-425-5p (MIRT016671)
- hsa-mir-142-3p (MIRT021639)
- hsa-mir-30b-5p (MIRT023458)
- hsa-mir-96-5p (MIRT027919)
- hsa-mir-190a-3p (MIRT116236)
- hsa-mir-297 (MIRT116239)
- hsa-mir-466 (MIRT116240)
- hsa-mir-3941 (MIRT116241)
- hsa-mir-4643 (MIRT116242)
- hsa-mir-4789-3p (MIRT116244)
- hsa-mir-5011-5p (MIRT116245)
- hsa-mir-6867-5p (MIRT116247)
- hsa-mir-8485 (MIRT116248)
- hsa-mir-124-5p (MIRT196428)
- hsa-mir-490-5p (MIRT196429)
- hsa-mir-1206 (MIRT196430)
- hsa-mir-1246 (MIRT196431)
- hsa-mir-27a-3p (MIRT196434)
- hsa-mir-27b-3p (MIRT196436)
- hsa-mir-144-5p (MIRT196437)
- hsa-mir-144-3p (MIRT196438)
- hsa-mir-1255a (MIRT196440)
- hsa-mir-1255b-5p (MIRT196441)
- hsa-mir-15a-5p (MIRT196450)
- hsa-mir-16-5p (MIRT196451)
- hsa-mir-15b-5p (MIRT196453)
- hsa-mir-195-5p (MIRT196455)
- hsa-mir-424-5p (MIRT196457)
- hsa-mir-497-5p (MIRT196458)
- hsa-mir-503-5p (MIRT196459)
- hsa-mir-646 (MIRT196460)
- hsa-mir-6838-5p (MIRT196467)
- hsa-mir-3908 (MIRT196474)
- hsa-mir-541-5p (MIRT196478)
- hsa-mir-374b-3p (MIRT196479)
- hsa-mir-4524a-5p (MIRT196480)
- hsa-mir-4524b-5p (MIRT196481)
- hsa-mir-4533 (MIRT196503)
- hsa-mir-3177-5p (MIRT196528)
- hsa-mir-7856-5p (MIRT196560)
- hsa-mir-18a-5p (MIRT196599)
- hsa-mir-24-3p (MIRT196600)
- hsa-mir-18b-5p (MIRT196601)
- hsa-mir-3190-3p (MIRT196602)
- hsa-mir-3202 (MIRT196603)
- hsa-mir-3677-5p (MIRT196604)
- hsa-mir-4735-3p (MIRT196606)
- hsa-mir-4795-5p (MIRT196607)
- hsa-mir-5585-3p (MIRT196608)
- hsa-mir-130a-3p (MIRT196620)
- hsa-mir-301a-3p (MIRT196621)
- hsa-mir-130b-3p (MIRT196622)
- hsa-mir-519c-3p (MIRT196623)
- hsa-mir-519b-3p (MIRT196624)
- hsa-mir-519a-3p (MIRT196625)
- hsa-mir-454-3p (MIRT196627)
- hsa-mir-301b-3p (MIRT196629)
- hsa-mir-1229-5p (MIRT196630)
- hsa-mir-4295 (MIRT196631)
- hsa-mir-3658 (MIRT196632)
- hsa-mir-3666 (MIRT196633)
- hsa-mir-4476 (MIRT196634)
- hsa-mir-6756-5p (MIRT196635)
- hsa-mir-6766-5p (MIRT196636)
- hsa-mir-6769a-5p (MIRT196637)
- hsa-mir-6769b-5p (MIRT196638)
- hsa-mir-6876-5p (MIRT196639)
- hsa-mir-8065 (MIRT196640)
- hsa-mir-2392 (MIRT196679)
- hsa-mir-4320 (MIRT286461)
- hsa-mir-3653-3p (MIRT286464)
- hsa-mir-2355-5p (MIRT286477)
- hsa-mir-625-5p (MIRT286483)
- hsa-mir-4284 (MIRT286500)
- hsa-mir-6504-3p (MIRT286505)
- hsa-mir-125a-3p (MIRT344615)
- hsa-mir-764 (MIRT344616)
- hsa-mir-3934-5p (MIRT344619)
- hsa-mir-1262 (MIRT344635)
- hsa-mir-4701-3p (MIRT344639)
- hsa-mir-6736-5p (MIRT344641)
- hsa-mir-27b-5p (MIRT386735)
- hsa-mir-3133 (MIRT386753)
- hsa-mir-4511 (MIRT386754)
- hsa-mir-511-3p (MIRT386755)
- hsa-mir-548at-5p (MIRT386758)
- hsa-mir-4477b (MIRT395279)
- hsa-mir-4684-5p (MIRT466624)
- hsa-mir-3165 (MIRT466625)
- hsa-mir-6880-5p (MIRT466626)
- hsa-mir-8071 (MIRT466627)
- hsa-mir-138-1-3p (MIRT466628)
- hsa-mir-1244 (MIRT466629)
- hsa-mir-5692c (MIRT466630)
- hsa-mir-5692b (MIRT466631)
- hsa-mir-1265 (MIRT466632)
- hsa-mir-128-3p (MIRT466633)
- hsa-mir-3681-3p (MIRT466634)
- hsa-mir-216a-3p (MIRT466635)
- hsa-mir-7641 (MIRT466636)
- hsa-mir-4662a-5p (MIRT466637)
- hsa-mir-876-5p (MIRT466638)
- hsa-mir-3167 (MIRT466639)
- hsa-mir-6768-3p (MIRT466640)
- hsa-mir-6741-5p (MIRT492087)
- hsa-mir-4483 (MIRT492088)
- hsa-mir-1293 (MIRT492089)
- hsa-mir-6745 (MIRT492090)
- hsa-mir-363-5p (MIRT492091)
- hsa-mir-3132 (MIRT492092)
- hsa-mir-197-5p (MIRT492093)
- hsa-mir-9-5p (MIRT492094)
- hsa-mir-3679-3p (MIRT492095)
- hsa-mir-3145-3p (MIRT492096)
- hsa-mir-4286 (MIRT492097)
- hsa-mir-181a-2-3p (MIRT492098)
- hsa-mir-892c-5p (MIRT492099)
- hsa-mir-580-5p (MIRT498040)
- hsa-mir-561-3p (MIRT498041)
- hsa-mir-5089-5p (MIRT520801)
- hsa-mir-6807-5p (MIRT520802)
- hsa-mir-7151-3p (MIRT520803)
- hsa-mir-5095 (MIRT520804)
- hsa-mir-5589-5p (MIRT520805)
- hsa-mir-4731-5p (MIRT520806)
- hsa-mir-6506-5p (MIRT520807)
- hsa-mir-619-5p (MIRT520808)
- hsa-mir-6884-3p (MIRT520809)
- hsa-mir-512-3p (MIRT520810)
- hsa-mir-552-3p (MIRT520811)
- hsa-mir-372-3p (MIRT520812)
- hsa-mir-373-3p (MIRT520813)
- hsa-mir-520b (MIRT520814)
- hsa-mir-520c-3p (MIRT520815)
- hsa-mir-520d-3p (MIRT520816)
- hsa-mir-302d-3p (MIRT520817)
- hsa-mir-520e (MIRT520818)
- hsa-mir-302c-3p (MIRT520819)
- hsa-mir-302b-3p (MIRT520820)
- hsa-mir-302e (MIRT520821)
- hsa-mir-302a-3p (MIRT520822)
- hsa-mir-520a-3p (MIRT520823)
- hsa-mir-1290 (MIRT540745)
- hsa-mir-223-5p (MIRT542648)
- hsa-mir-567 (MIRT542649)
- hsa-mir-603 (MIRT546349)
- hsa-mir-362-3p (MIRT546350)
- hsa-mir-329-3p (MIRT546351)
- hsa-mir-525-5p (MIRT553758)
- hsa-mir-520a-5p (MIRT553759)
- hsa-mir-549a (MIRT553760)
- hsa-mir-676-5p (MIRT553761)
- hsa-mir-4661-3p (MIRT553762)
- hsa-mir-1303 (MIRT621883)
- hsa-mir-5096 (MIRT621884)
- hsa-mir-197-3p (MIRT621885)
- hsa-mir-411-5p (MIRT621886)
- hsa-mir-6832-5p (MIRT621887)
- hsa-mir-193b-5p (MIRT621888)
- hsa-mir-483-5p (MIRT621889)
- hsa-mir-6894-3p (MIRT638190)
- hsa-mir-5001-3p (MIRT638191)
- hsa-mir-378a-5p (MIRT638192)
- hsa-mir-4763-5p (MIRT638193)
- hsa-mir-6778-3p (MIRT638194)
- hsa-mir-6821-3p (MIRT638195)
- hsa-mir-6790-3p (MIRT638196)
- hsa-mir-3653-5p (MIRT638197)
- hsa-mir-6747-3p (MIRT638198)
- hsa-mir-4777-5p (MIRT641844)
- hsa-mir-523-5p (MIRT641845)
- hsa-mir-526a (MIRT641846)
- hsa-mir-522-5p (MIRT641847)
- hsa-mir-520c-5p (MIRT641848)
- hsa-mir-519c-5p (MIRT641849)
- hsa-mir-519b-5p (MIRT641850)
- hsa-mir-519a-5p (MIRT641851)
- hsa-mir-518f-5p (MIRT641852)
- hsa-mir-518e-5p (MIRT641853)
- hsa-mir-518d-5p (MIRT641854)
- hsa-mir-6837-3p (MIRT641855)
- hsa-mir-4305 (MIRT641856)
- hsa-mir-6787-3p (MIRT641857)
- hsa-mir-578 (MIRT652818)
- hsa-mir-4753-3p (MIRT652819)
- hsa-mir-6892-5p (MIRT652820)
- hsa-mir-4793-5p (MIRT652821)
- hsa-mir-5196-3p (MIRT652822)
- hsa-mir-501-5p (MIRT652823)
- hsa-mir-6856-3p (MIRT652824)
- hsa-mir-4475 (MIRT652825)
- hsa-mir-640 (MIRT665950)
- hsa-mir-6853-3p (MIRT683185)
- hsa-mir-1277-5p (MIRT707849)
- hsa-mir-4665-5p (MIRT712137)
- hsa-mir-1275 (MIRT712138)
- hsa-mir-588 (MIRT712139)
- hsa-mir-4701-5p (MIRT712140)
- hsa-mir-5010-5p (MIRT712141)
- hsa-mir-4525 (MIRT712142)
- hsa-mir-7111-5p (MIRT712143)
- hsa-mir-6870-5p (MIRT712144)
- hsa-mir-5698 (MIRT712145)
- hsa-mir-4723-5p (MIRT712146)
- hsa-mir-3175 (MIRT712147)
- hsa-mir-8085 (MIRT712148)
- hsa-mir-6731-5p (MIRT712149)
- hsa-mir-4644 (MIRT712150)
- hsa-mir-4306 (MIRT712151)
- hsa-mir-185-5p (MIRT712152)
- hsa-mir-7106-3p (MIRT712153)
- hsa-mir-4252 (MIRT712154)
- hsa-mir-2467-5p (MIRT712155)
- hsa-mir-637 (MIRT712156)
- hsa-mir-3162-3p (MIRT712157)
- hsa-mir-6856-5p (MIRT712158)
- hsa-mir-6758-5p (MIRT712159)
- hsa-mir-942-3p (MIRT712160)
- hsa-mir-30e-5p (MIRT726386)
- hsa-mir-30d-5p (MIRT726387)
- hsa-mir-30c-5p (MIRT726388)
- hsa-mir-30a-5p (MIRT726389)
- hsa-mir-1289 (MIRT783413)
- hsa-mir-129-5p (MIRT783608)
- hsa-mir-3672 (MIRT785163)
- hsa-mir-6864-3p (MIRT789168)
- hsa-mir-8055 (MIRT789738)
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK1
- genomics-online: shRNA clones - Search results for available TAOK1 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * TAOK1 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
- Sino Biological Human cDNA Clone for TAOK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for TAOK1
- genomics-online: cdna clones - Search results for available TAOK1 gene related products
- orf clones - Search results for available TAOK1 gene related products
Cell Line Products
-
Horizon Cell Lines for TAOK1
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for TAOK1 Gene
Localization for TAOK1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for TAOK1 Gene
- Cytoplasm.
| Compartment | Confidence |
|---|---|
| cytoskeleton | 4 |
| nucleus | 4 |
| cytosol | 4 |
- Vesicles (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IBA | 21873635 |
| GO:0005737 | cytoplasm | IBA | 21873635 |
| GO:0005829 | cytosol | TAS | -- |
| GO:0015630 | microtubule cytoskeleton | IMP | 12639963 |
| GO:0048471 | perinuclear region of cytoplasm | IMP | 12639963 |
Pathways & Interactions for TAOK1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Cell Cycle, Mitotic |
.83
|
.60
|
| 2 | Mitotic Metaphase and Anaphase |
.94
|
|
| 3 | Mitotic Prometaphase | ||
| 4 | MAPK signaling pathway | ||
| 5 | Signaling by Rho GTPases | ||
Pathways by source for TAOK1 Gene
2 BioSystems pathways for TAOK1 Gene
12 Reactome pathways for TAOK1 Gene
1 KEGG pathway for TAOK1 Gene
Interacting Proteins for TAOK1 Gene
Selected Interacting proteins:
Q7L7X3-TAOK1_HUMAN
ENSP00000261716
for TAOK1 Gene via
MINT
STRING
IID
GPS-Prot Interaction Network for TAOK1
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000186 | activation of MAPKK activity | IBA | 21873635 |
| GO:0000187 | activation of MAPK activity | TAS | 22683681 |
| GO:0000226 | microtubule cytoskeleton organization | IMP | 12639963 |
| GO:0006281 | DNA repair | IEA | -- |
| GO:0006468 | protein phosphorylation | NAS | 14517247 |
Drugs & Compounds for TAOK1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor | 58-64-0 |
|
Drug Products
- Atlas Antibodies PrEST Antigen TAOK1
Transcripts for TAOK1 Gene
mRNA/cDNA for TAOK1 Gene
- (2) REFSEQ mRNAs :
- (19) Additional mRNA sequences :
- (82) Selected AceView cDNA sequences:
- (6) Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000261716 12407 bps (ENST00000261716.7)
- ENST00000536202 4068 bps (ENST00000536202.1)
- ENST00000577583 5557 bps (ENST00000577583.1)
- ENST00000578653 564 bps (ENST00000578653.1)
- ENST00000583121 526 bps (ENST00000583121.5)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * TAOK1 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
OriGene CRISPR knockouts for TAOK1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for TAOK1
- genomics-online: gRNA clones - Search results for available TAOK1 gene related products
-
Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK1
- genomics-online: shRNA clones - Search results for available TAOK1 gene related products
Clone Products
- Applied Biological Materials (abm): Clones for TAOK1 - Select products 50% OFF >
- * TAOK1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * TAOK1 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
- Sino Biological Human cDNA Clone for TAOK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for TAOK1
- genomics-online: cdna clones - Search results for available TAOK1 gene related products
- orf clones - Search results for available TAOK1 gene related products
| ExUns: | 1 | ^ | 2a | · | 2b | ^ | 3 | ^ | 4a | · | 4b | · | 4c | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9a | · | 9b | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19 | ^ | 20 | ^ | 21 | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - |
| ExUns: | 22 |
|---|---|
| SP1: | |
| SP2: | |
| SP3: | |
| SP4: |
Expression for TAOK1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Blood (Hematopoietic System)
- Proerythroblasts Hematopoietic Bone Marrow
- pre Conventional Dendritic Cells Peripheral Blood
- Double Positive Thymocytes Thymus
-
Thymus (Hematopoietic System)
- Double Positive Thymocytes Thymus
- Eye (Sensory Organs)
This gene is overexpressed in Peripheral blood mononuclear cells (35.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for TAOK1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of TAOK1 Gene:
TAOK1SOURCE GeneReport for Unigene cluster for TAOK1 Gene:
Hs.597434mRNA Expression by UniProt/SwissProt for TAOK1 Gene:
Q7L7X3-TAOK1_HUMAN
Tissue specificity:
Highly expressed in the testis, and to a lower extent also expressed in brain, placenta, colon and skeletal muscle.
Evidence on tissue expression from TISSUES for TAOK1 Gene
- Nervous system(4.8)
- Blood(4.3)
- Liver(4.3)
- Lung(2.3)
Primer Products
-
OriGene qPCR primer pairs for TAOK1
- genomics-online: primer clones - Search results for available TAOK1 gene related products
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for TAOK1 Gene
Orthologs for TAOK1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | TAOK1 33 32 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | TAOK1 33 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | TAOK1 33 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | TAOK1 33 32 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | TAOK1 33 32 |
|
OneToOne | |
| rat (Rattus norvegicus) |
Mammalia | Taok1 32 |
|
||
| mouse (Mus musculus) |
Mammalia | Taok1 17 33 32 |
|
||
| chicken (Gallus gallus) |
Aves | TAOK1 33 32 |
|
OneToOne | |
| lizard (Anolis carolinensis) |
Reptilia | TAOK1 33 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | taok1 32 |
|
||
| Str.6620 32 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | MGC52943 32 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | TAOK1 (2 of 3) 33 |
|
OneToMany | |
| taok1 33 |
|
OneToMany | |||
| CU929119.2 33 |
|
OneToMany | |||
| LOC100004576 32 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | Tao 33 32 |
|
OneToMany | |
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP003202 32 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | kin-18 33 32 |
|
OneToMany | |
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 33 |
|
OneToMany | |
| Cin.8830 32 |
|
||||
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.8830 32 |
|
- Species where no ortholog for TAOK1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Evolution for TAOK1 Gene
- ENSEMBL:
- Gene Tree for TAOK1 (if available)
- TreeFam:
- Gene Tree for TAOK1 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for TAOK1: view image
Paralogs for TAOK1 Gene
Paralogs for TAOK1 Gene
(8) SIMAP similar genes for TAOK1 Gene using alignment to 2 proteins:
- TAOK1_HUMAN
- J3QS76_HUMAN
Variants for TAOK1 Gene
| SNP ID | Clin | Chr 17 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1555564792 | not-provided, not provided | 29,491,859(+) | T/TCT | coding_sequence_variant, frameshift | |
| rs1000013501 | -- | 29,418,288(+) | A/G | intron_variant | |
| rs1000047173 | -- | 29,425,133(+) | G/A | intron_variant | |
| rs1000050318 | -- | 29,525,382(+) | ATTACA/A | intron_variant | |
| rs1000065096 | -- | 29,437,932(+) | T/C | intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv22895 | CNV | loss | 19812545 |
| esv2335781 | CNV | deletion | 18987734 |
| esv2474903 | CNV | deletion | 19546169 |
| esv2658989 | CNV | deletion | 23128226 |
| esv2673792 | CNV | deletion | 23128226 |
| esv2715797 | CNV | deletion | 23290073 |
| esv3303028 | CNV | tandem duplication | 20981092 |
| esv3405501 | CNV | insertion | 20981092 |
| esv3582597 | CNV | loss | 25503493 |
| esv3640327 | CNV | loss | 21293372 |
| esv994280 | OTHER | inversion | 20482838 |
| nsv1077840 | CNV | duplication | 25765185 |
| nsv819892 | CNV | loss | 19587683 |
| nsv821292 | CNV | duplication | 20802225 |
| nsv827940 | CNV | gain | 20364138 |
| nsv833409 | CNV | gain | 17160897 |
Residual Variation Intolerance Score:
4.52% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.48;
28.86% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for TAOK1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- TAOK1
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TAOK1 Gene
Disorders for TAOK1 Gene
Additional Disease Information for TAOK1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for TAOK1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for TAOK1 Gene
Publications for TAOK1 Gene
- Human TAO kinase 1 induces apoptosis in SH-SY5Y cells. (PMID: 17900936) Wu MF … Wang SG (Cell biology international 2008) 3 4 23 56
- A functional genomic screen identifies a role for TAO1 kinase in spindle-checkpoint signalling. (PMID: 17417629) Draviam VM … Elledge SJ (Nature cell biology 2007) 3 4 23 56
- MARKK, a Ste20-like kinase, activates the polarity-inducing kinase MARK/PAR-1. (PMID: 14517247) Timm T … Mandelkow EM (The EMBO journal 2003) 2 3 23 56
- Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10718198) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2000) 2 3 4 56
- New gene functions in megakaryopoiesis and platelet formation. (PMID: 22139419) Gieger C … Soranzo N (Nature 2011) 3 43 56
ExternalLinks
Products for TAOK1 Gene
- Custom Antibody ServicesOriGene Antibodies for TAOK1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for TAOK1
- Search Origene for MassSpec and Protein Over-expression Lysates for TAOK1
- Origene Custom Protein Services for TAOK1
- Origene sirna, shrna, and RNAi products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- OriGene qPCR primer pairs for TAOK1
- OriGene CRISPR knockouts for TAOK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For TAOK1
- Sino Biological Human cDNA Clone for TAOK1
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for TAOK1
- Novus Biologicals proteins and lysates for TAOK1
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for TAOK1
- Abcam proteins for TAOK1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for TAOK1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for TAOK1 (AFLGC-TAOK1)
- antibodies-online: Show 23 available TAOK1 Antibodies ranked by validation data
- Compare Top TAOK1 Antibodies
- antibodies-online: Show 6 available TAOK1 Elisa Kits ranked by validation data
- Compare Top TAOK1 Elisa Kits
- Quality Products:
- antibodies-online: Show 5 available TAOK1 Proteins ranked by validation data
- Compare Top TAOK1 Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for TAOK1
- Search Santa Cruz Biotechnology (SCBT) for TAOK1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
- Horizon Cell Lines for TAOK1
- genomics-online: cdna clones - Search results for available TAOK1 gene related products
- orf clones - Search results for available TAOK1 gene related products
- genomics-online: gRNA clones - Search results for available TAOK1 gene related products
- genomics-online: primer clones - Search results for available TAOK1 gene related products
- genomics-online: shRNA clones - Search results for available TAOK1 gene related products
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for TAOK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for TAOK1
- Search GeneCopoeia for miRNA 3'UTR Target clone products for TAOK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for TAOK1
- Boster Bio Antibodies for TAOK1
- Browse Boster Bio ELISA Kits
Sources for TAOK1 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) CGAP SAGE
- (31) SOURCE
- (32) HomoloGene
- (33) PanEnsembl
- (34) euGenes
- (35) SGD
- (36) FlyBase
- (37) WormBase
- (38) Pseudogene
- (39) DGV
- (40) dbSNP
- (41) GenAtlas
- (42) HGMD
- (43) GAD
- (44) BGMUT
- (45) HuGE
- (46) Atlas
- (47) GenBank
- (48) H-invDB
- (49) HORDE
- (50) HUGE
- (51) IMGT
- (52) Leiden
- (53) miRBase
- (54) DME
- (55) OriGene
- (56) PubMed
- (57) R&D Systems
- (58) TGDB
- (59) Tocris
- (60) Abcam
- (61) Novus Biologicals
- (62) ProSpec
- (63) Sino Biological
- (64) GenScript
- (65) Qiagen
- (66) OCA
- (67) Proteopedia
- (68) MOPED
- (69) neXtProt
- (70) Reactome
- (71) GeneGo (Thomson Reuters)
- (72) DISEASES
- (73) SIMAP
- (74) GenomeRNAi
- (75) LifeMap
- (76) miRTarBase
- (77) MalaCards
- (78) Invitrogen
- (79) BitterDB
- (80) ESI-BIO
- (81) RefSeq
- (82) BioSystems
- (83) MaxQB
- (84) IUPHAR
- (85) BioGPS
- (86) Illumina
- (87) COMPARTMENTS
- (88) HOMER
- (89) PaxDb
- (90) ApexBio
- (91) Addgene
- (92) antibodies-online
- (93) CYP
- (94) NONCODE
- (95) TreeFam
- (96) PathCards
- (97) GeneReviews
- (98) GeneTex
- (99) Taconic Biosciences
- (100) GTEx
- (101) ProteomicsDB
- (102) SCBT
- (103) DGIdb
- (104) ClinicalTrials
- (105) RVIS
- (106) SIGNOR
- (107) diseasecard
- (108) NIH Rare Diseases
- (109) Orphanet
- (110) UMLS
- (111) GTR
- (112) Disease Ontology
- (113) Genetics Home Reference
- (114) MeSH
- (115) MedlinePlus
- (116) CDC
- (117) NINDS
- (118) NCBI Bookshelf
- (119) ClinVar
- (120) Gene Damage Index
- (121) HPO
- (122) UDN
- (123) VISTA
- (124) FANTOM5
- (125) ENCODE
- (126) ProSci
- (127) Horizon
- (128) NURSA
- (129) IID
- (130) VectorBuilder
- (131) SNPedia
- (132) BRCA Exchange
- (133) CIViC
- (134) ProteoGenix
- (135) dbSUPER
- (136) TISSUES
- (137) Gene ORGANizer
- (138) abm
- (139) Human Protein Atlas
- (140) GWAS Catalog
- (141) Monarch Initiative
- (142) DataMed
- (143) HumanCyc
- (144) genomics-online
- (145) UCNEbase
- (146) EPDnew
- (147) Applied Biosystems
- (148) GlyConnect
- (149) Aminode
- (150) GeneCopoeia
- (151) GPS-Prot
- (152) RNACentral
- (153) LncRNADisease
- (154) LOVD
- (155) miR2Disease
- (156) DiseaseEnhancer
- (157) Boster Bio
- (158) Biorbyt
- (159) Biocompare
- (160) Mastermind
- (161) CTD^2 Dashboard
- (162) CraniofacialAtlas
- (163) GeneImprint
- (164) Synthego
- (165) Bio Basic
- (166) ENA
- (167) GtRNAdb
- (168) LncBase
- (169) LncBook
- (170) LNCipedia
- (171) LncRNAdb
- (172) Modomics
- (173) PDBe
- (174) Rfam
- (175) SILVA
- (176) snOPY
- (177) SRPDB
- (178) GENCODE
- (179) TarBase
- (180) MyBioSource