Aliases for TAOK1 Gene
Aliases for TAOK1 Gene
External Ids for TAOK1 Gene
- HGNC: 29259
- Entrez Gene: 57551
- Ensembl: ENSG00000160551
- OMIM: 610266
- UniProtKB: Q7L7X3
Previous GeneCards Identifiers for TAOK1 Gene
- GC17P024742
- GC17P027717
- GC17P023926
Summaries for TAOK1 Gene
GeneCards Summary for TAOK1 Gene
TAOK1 (TAO Kinase 1) is a Protein Coding gene. Diseases associated with TAOK1 include Chromosome 17Q11.2 Deletion Syndrome, 1.4-Mb. Among its related pathways are MAPK signaling pathway and Signaling by Rho GTPases. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TAOK3.
UniProtKB/Swiss-Prot for TAOK1 Gene
-
Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating Thr-208 of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TAOK1 Gene
Genomics for TAOK1 Gene
GeneHancer (GH) Regulatory Elements for TAOK1 Gene
Promoters and enhancers for TAOK1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around TAOK1 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for TAOK1 Gene
Genomic Locations for TAOK1 Gene
- chr17:29,390,464-29,551,904
- (GRCh38/hg38)
- Size:
- 161,441 bases
- Orientation:
- Plus strand
- chr17:27,717,482-27,878,922
- (GRCh37/hg19)
Genomic View for TAOK1 Gene
Genes around TAOK1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 17q11.2 by Ensembl
- 17q11.2 by Entrez Gene
- 17q11.2 by HGNC
TAOK1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for TAOK1 Gene
Proteins for TAOK1 Gene
-
Protein details for TAOK1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q7L7X3-TAOK1_HUMAN
- Recommended name:
- Serine/threonine-protein kinase TAO1
- Protein Accession:
- Q7L7X3
- A2RUT8
- B7ZLV6
- Q96L75
- Q9H2K7
- Q9H7S5
- Q9P2I6
Protein attributes for TAOK1 Gene
- Size:
- 1001 amino acids
- Molecular mass:
- 116070 Da
- Quaternary structure:
-
- Self-associates. Interacts with MAP2K3 (By similarity). Interacts with SPRED1 and TESK1. Interacts with MAP3K7.
- SequenceCaution:
-
- Sequence=BAA92599.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Protein Expression for TAOK1 Gene
Selected DME Specific Peptides for TAOK1 Gene
- Q7L7X3:
-
- DIKAGNIL
- KKMSYSGKQ
- ELLNAYQSKIK
- LQHQTEL
- LENKLKAEMDEHRLRLDKDLETQRNNF
- DEAQEAECQ
- QALRLDE
- LEQRVSL
- THGALQGLAYLHSH
- WSHNPTGG
- TCKIQTRQYKALR
- QIKKQFQ
- QEHEQDS
- FVLRERP
- EIGHGSFGAVYFA
- LECRRFKRRMLL
- ENQSTPK
- YDGKVDV
- EKWQDIIKEV
- WSLGITCIELAER
- RKEQLKEEL
- VKLADFG
- QTQKDLE
- QELEFRHL
- EYKGCYL
- KAGNILL
- ERIRSLLERQAREIEAFD
- ERELRRK
- SPPQVSRHKSHYRNREHFATIRTASLVTRQ
- MNAMSALYHIAQN
- SGYKRMRRQHQKQL
- HRDIKAGN
- WMAPEVI
- QHFQAEEEANLLRRQRQYL
- SRSTSVTSQ
- EQTRKLAILAEQY
- SDDKSELDMMEGDHTVMSNSSVIHLKPEEENY
- LKDPEIAELFFKEDPE
- IEEEMLALQ
- EWSDYFRNFVDSCL
- HLLETTPK
- GSNQSIPSMSISASSQSSSV
- EKKFQQHIQAQQKKELN
- GTPYWMAPE
- VLIDLIQRTKDAVRELDNLQYRKMKK
- NQLEYNKRRE
Post-translational modifications for TAOK1 Gene
- Autophosphorylated (By similarity). Phosphorylated by ATM in response to DNA damage. Phosphorylated by LRRK2.
- Proteolytically processed by caspase-3 (CASP3).
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for TAOK1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for TAOK1
- Novus Biologicals Antibodies for TAOK1
-
Abcam antibodies for TAOK1
- Invitrogen Antibodies for TAOK1
- Search GeneTex for Antibodies for TAOK1
-
Santa Cruz Biotechnology (SCBT) Antibodies for TAOK1
Protein Products
-
OriGene Purified Proteins for TAOK1
- Search Origene for MassSpec and Protein Over-expression Lysates for TAOK1
- Origene Custom Protein Services for TAOK1
- antibodies-online: Search results for 5 available TAOK1 Proteins ranked by validation data
- Compare Top TAOK1 Proteins
-
Quality Products:
- Search GeneTex for Proteins for TAOK1
-
Abcam proteins for TAOK1
Assay Products
- antibodies-online: Search results for 4 available TAOK1 Elisa Kits ranked by validation data
- Compare Top TAOK1 Elisa Kits
-
Quality Products:
Domains & Families for TAOK1 Gene
Gene Families for TAOK1 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for TAOK1 Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for TAOK1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q7L7X3UniProtKB/Swiss-Prot:
TAOK1_HUMAN :- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Function for TAOK1 Gene
Molecular function for TAOK1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Serine/threonine-protein kinase activity is inhibited by SPRED1.
- UniProtKB/Swiss-Prot Function:
- Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating Thr-208 of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
- UniProtKB/Swiss-Prot Induction:
- In response to DNA damage.
Enzyme Numbers (IUBMB) for TAOK1 Gene
Phenotypes From GWAS Catalog for TAOK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0004672 | protein kinase activity | ISS,NAS | 14517247 |
| GO:0004674 | protein serine/threonine kinase activity | NAS | 14517247 |
| GO:0004709 | MAP kinase kinase kinase activity | IBA | -- |
| GO:0005515 | protein binding | IPI | 11733138 |
Phenotypes for TAOK1 Gene
- GenomeRNAi human phenotypes for TAOK1:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Synthetic lethal with Ras
- Decreased p24 protein expression
- Increased transferrin (TF) endocytosis
- Decreased shRNA abundance (Z-score < -2)
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Decreased substrate adherent cell growth
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, increased FA abundance
- Decreased homologous recombination repair frequency
- Weakly decreased NFAT1-GFP nuclear translocation
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Decreased Tat-dependent transcription
- Reduced beta-catenin activity and colon cancer cell proliferation
Animal Model Products
-
Taconic Biosciences Mouse Models for TAOK1
- Cyagen custom Knockout/knockin (KOKI) mouse models for TAOK1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for TAOK1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for TAOK1 gene
- Search ViGene Biosciences for TAOK1
CRISPR Products
-
OriGene CRISPR knockouts for TAOK1
- genomics-online: gRNA clones - Search results for available TAOK1 gene related products
- Applied Biological Materials CRISPR for TAOK1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
- GenScript: Design CRISPR guide RNA sequences for TAOK1
miRNA for TAOK1 Gene
- miRTarBase miRNAs that target TAOK1
-
- hsa-mir-425-5p (MIRT016671)
- hsa-mir-142-3p (MIRT021639)
- hsa-mir-30b-5p (MIRT023458)
- hsa-mir-96-5p (MIRT027919)
- hsa-mir-190a-3p (MIRT116236)
- hsa-mir-297 (MIRT116239)
- hsa-mir-466 (MIRT116240)
- hsa-mir-3941 (MIRT116241)
- hsa-mir-4643 (MIRT116242)
- hsa-mir-4789-3p (MIRT116244)
- hsa-mir-5011-5p (MIRT116245)
- hsa-mir-6867-5p (MIRT116247)
- hsa-mir-8485 (MIRT116248)
- hsa-mir-124-5p (MIRT196428)
- hsa-mir-490-5p (MIRT196429)
- hsa-mir-1206 (MIRT196430)
- hsa-mir-1246 (MIRT196431)
- hsa-mir-27a-3p (MIRT196434)
- hsa-mir-27b-3p (MIRT196436)
- hsa-mir-144-5p (MIRT196437)
- hsa-mir-144-3p (MIRT196438)
- hsa-mir-1255a (MIRT196440)
- hsa-mir-1255b-5p (MIRT196441)
- hsa-mir-15a-5p (MIRT196450)
- hsa-mir-16-5p (MIRT196451)
- hsa-mir-15b-5p (MIRT196453)
- hsa-mir-195-5p (MIRT196455)
- hsa-mir-424-5p (MIRT196457)
- hsa-mir-497-5p (MIRT196458)
- hsa-mir-503-5p (MIRT196459)
- hsa-mir-646 (MIRT196460)
- hsa-mir-6838-5p (MIRT196467)
- hsa-mir-3908 (MIRT196474)
- hsa-mir-541-5p (MIRT196478)
- hsa-mir-374b-3p (MIRT196479)
- hsa-mir-4524a-5p (MIRT196480)
- hsa-mir-4524b-5p (MIRT196481)
- hsa-mir-4533 (MIRT196503)
- hsa-mir-3177-5p (MIRT196528)
- hsa-mir-7856-5p (MIRT196560)
- hsa-mir-18a-5p (MIRT196599)
- hsa-mir-24-3p (MIRT196600)
- hsa-mir-18b-5p (MIRT196601)
- hsa-mir-3190-3p (MIRT196602)
- hsa-mir-3202 (MIRT196603)
- hsa-mir-3677-5p (MIRT196604)
- hsa-mir-4735-3p (MIRT196606)
- hsa-mir-4795-5p (MIRT196607)
- hsa-mir-5585-3p (MIRT196608)
- hsa-mir-130a-3p (MIRT196620)
- hsa-mir-301a-3p (MIRT196621)
- hsa-mir-130b-3p (MIRT196622)
- hsa-mir-519c-3p (MIRT196623)
- hsa-mir-519b-3p (MIRT196624)
- hsa-mir-519a-3p (MIRT196625)
- hsa-mir-454-3p (MIRT196627)
- hsa-mir-301b-3p (MIRT196629)
- hsa-mir-1229-5p (MIRT196630)
- hsa-mir-4295 (MIRT196631)
- hsa-mir-3658 (MIRT196632)
- hsa-mir-3666 (MIRT196633)
- hsa-mir-4476 (MIRT196634)
- hsa-mir-6756-5p (MIRT196635)
- hsa-mir-6766-5p (MIRT196636)
- hsa-mir-6769a-5p (MIRT196637)
- hsa-mir-6769b-5p (MIRT196638)
- hsa-mir-6876-5p (MIRT196639)
- hsa-mir-8065 (MIRT196640)
- hsa-mir-2392 (MIRT196679)
- hsa-mir-4320 (MIRT286461)
- hsa-mir-3653-3p (MIRT286464)
- hsa-mir-2355-5p (MIRT286477)
- hsa-mir-625-5p (MIRT286483)
- hsa-mir-4284 (MIRT286500)
- hsa-mir-6504-3p (MIRT286505)
- hsa-mir-125a-3p (MIRT344615)
- hsa-mir-764 (MIRT344616)
- hsa-mir-3934-5p (MIRT344619)
- hsa-mir-1262 (MIRT344635)
- hsa-mir-4701-3p (MIRT344639)
- hsa-mir-6736-5p (MIRT344641)
- hsa-mir-27b-5p (MIRT386735)
- hsa-mir-3133 (MIRT386753)
- hsa-mir-4511 (MIRT386754)
- hsa-mir-511-3p (MIRT386755)
- hsa-mir-548at-5p (MIRT386758)
- hsa-mir-4477b (MIRT395279)
- hsa-mir-4684-5p (MIRT466624)
- hsa-mir-3165 (MIRT466625)
- hsa-mir-6880-5p (MIRT466626)
- hsa-mir-8071 (MIRT466627)
- hsa-mir-138-1-3p (MIRT466628)
- hsa-mir-1244 (MIRT466629)
- hsa-mir-5692c (MIRT466630)
- hsa-mir-5692b (MIRT466631)
- hsa-mir-1265 (MIRT466632)
- hsa-mir-128-3p (MIRT466633)
- hsa-mir-3681-3p (MIRT466634)
- hsa-mir-216a-3p (MIRT466635)
- hsa-mir-7641 (MIRT466636)
- hsa-mir-4662a-5p (MIRT466637)
- hsa-mir-876-5p (MIRT466638)
- hsa-mir-3167 (MIRT466639)
- hsa-mir-6768-3p (MIRT466640)
- hsa-mir-6741-5p (MIRT492087)
- hsa-mir-4483 (MIRT492088)
- hsa-mir-1293 (MIRT492089)
- hsa-mir-6745 (MIRT492090)
- hsa-mir-363-5p (MIRT492091)
- hsa-mir-3132 (MIRT492092)
- hsa-mir-197-5p (MIRT492093)
- hsa-mir-9-5p (MIRT492094)
- hsa-mir-3679-3p (MIRT492095)
- hsa-mir-3145-3p (MIRT492096)
- hsa-mir-4286 (MIRT492097)
- hsa-mir-181a-2-3p (MIRT492098)
- hsa-mir-892c-5p (MIRT492099)
- hsa-mir-580-5p (MIRT498040)
- hsa-mir-561-3p (MIRT498041)
- hsa-mir-5089-5p (MIRT520801)
- hsa-mir-6807-5p (MIRT520802)
- hsa-mir-7151-3p (MIRT520803)
- hsa-mir-5095 (MIRT520804)
- hsa-mir-5589-5p (MIRT520805)
- hsa-mir-4731-5p (MIRT520806)
- hsa-mir-6506-5p (MIRT520807)
- hsa-mir-619-5p (MIRT520808)
- hsa-mir-6884-3p (MIRT520809)
- hsa-mir-512-3p (MIRT520810)
- hsa-mir-552-3p (MIRT520811)
- hsa-mir-372-3p (MIRT520812)
- hsa-mir-373-3p (MIRT520813)
- hsa-mir-520b (MIRT520814)
- hsa-mir-520c-3p (MIRT520815)
- hsa-mir-520d-3p (MIRT520816)
- hsa-mir-302d-3p (MIRT520817)
- hsa-mir-520e (MIRT520818)
- hsa-mir-302c-3p (MIRT520819)
- hsa-mir-302b-3p (MIRT520820)
- hsa-mir-302e (MIRT520821)
- hsa-mir-302a-3p (MIRT520822)
- hsa-mir-520a-3p (MIRT520823)
- hsa-mir-1290 (MIRT540745)
- hsa-mir-223-5p (MIRT542648)
- hsa-mir-567 (MIRT542649)
- hsa-mir-603 (MIRT546349)
- hsa-mir-362-3p (MIRT546350)
- hsa-mir-329-3p (MIRT546351)
- hsa-mir-525-5p (MIRT553758)
- hsa-mir-520a-5p (MIRT553759)
- hsa-mir-549a (MIRT553760)
- hsa-mir-676-5p (MIRT553761)
- hsa-mir-4661-3p (MIRT553762)
- hsa-mir-1303 (MIRT621883)
- hsa-mir-5096 (MIRT621884)
- hsa-mir-197-3p (MIRT621885)
- hsa-mir-411-5p (MIRT621886)
- hsa-mir-6832-5p (MIRT621887)
- hsa-mir-193b-5p (MIRT621888)
- hsa-mir-483-5p (MIRT621889)
- hsa-mir-6894-3p (MIRT638190)
- hsa-mir-5001-3p (MIRT638191)
- hsa-mir-378a-5p (MIRT638192)
- hsa-mir-4763-5p (MIRT638193)
- hsa-mir-6778-3p (MIRT638194)
- hsa-mir-6821-3p (MIRT638195)
- hsa-mir-6790-3p (MIRT638196)
- hsa-mir-3653-5p (MIRT638197)
- hsa-mir-6747-3p (MIRT638198)
- hsa-mir-4777-5p (MIRT641844)
- hsa-mir-523-5p (MIRT641845)
- hsa-mir-526a (MIRT641846)
- hsa-mir-522-5p (MIRT641847)
- hsa-mir-520c-5p (MIRT641848)
- hsa-mir-519c-5p (MIRT641849)
- hsa-mir-519b-5p (MIRT641850)
- hsa-mir-519a-5p (MIRT641851)
- hsa-mir-518f-5p (MIRT641852)
- hsa-mir-518e-5p (MIRT641853)
- hsa-mir-518d-5p (MIRT641854)
- hsa-mir-6837-3p (MIRT641855)
- hsa-mir-4305 (MIRT641856)
- hsa-mir-6787-3p (MIRT641857)
- hsa-mir-578 (MIRT652818)
- hsa-mir-4753-3p (MIRT652819)
- hsa-mir-6892-5p (MIRT652820)
- hsa-mir-4793-5p (MIRT652821)
- hsa-mir-5196-3p (MIRT652822)
- hsa-mir-501-5p (MIRT652823)
- hsa-mir-6856-3p (MIRT652824)
- hsa-mir-4475 (MIRT652825)
- hsa-mir-640 (MIRT665950)
- hsa-mir-6853-3p (MIRT683185)
- hsa-mir-1277-5p (MIRT707849)
- hsa-mir-4665-5p (MIRT712137)
- hsa-mir-1275 (MIRT712138)
- hsa-mir-588 (MIRT712139)
- hsa-mir-4701-5p (MIRT712140)
- hsa-mir-5010-5p (MIRT712141)
- hsa-mir-4525 (MIRT712142)
- hsa-mir-7111-5p (MIRT712143)
- hsa-mir-6870-5p (MIRT712144)
- hsa-mir-5698 (MIRT712145)
- hsa-mir-4723-5p (MIRT712146)
- hsa-mir-3175 (MIRT712147)
- hsa-mir-8085 (MIRT712148)
- hsa-mir-6731-5p (MIRT712149)
- hsa-mir-4644 (MIRT712150)
- hsa-mir-4306 (MIRT712151)
- hsa-mir-185-5p (MIRT712152)
- hsa-mir-7106-3p (MIRT712153)
- hsa-mir-4252 (MIRT712154)
- hsa-mir-2467-5p (MIRT712155)
- hsa-mir-637 (MIRT712156)
- hsa-mir-3162-3p (MIRT712157)
- hsa-mir-6856-5p (MIRT712158)
- hsa-mir-6758-5p (MIRT712159)
- hsa-mir-942-3p (MIRT712160)
- hsa-mir-30e-5p (MIRT726386)
- hsa-mir-30d-5p (MIRT726387)
- hsa-mir-30c-5p (MIRT726388)
- hsa-mir-30a-5p (MIRT726389)
- hsa-mir-1289 (MIRT783413)
- hsa-mir-129-5p (MIRT783608)
- hsa-mir-3672 (MIRT785163)
- hsa-mir-6864-3p (MIRT789168)
- hsa-mir-8055 (MIRT789738)
miRNA Products
- Search ViGene Biosciences for TAOK1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- genomics-online: shRNA clones - Search results for available TAOK1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for TAOK1 gene
Clone Products
- VectorBuilder custom plasmid, inducible vectors for TAOK1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for TAOK1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for available TAOK1 gene related products
- orf clones - Search results for available TAOK1 gene related products
- Applied Biological Materials Clones for TAOK1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for TAOK1
-
ViGene Biosciences adenoviral particle packaged cDNA for TAOK1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for TAOK1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for TAOK1 gene
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for TAOK1 Gene
Localization for TAOK1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for TAOK1 Gene
- Cytoplasm.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| cytosol | 5 |
| nucleus | 3 |
| cytoskeleton | 2 |
- Vesicles (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005737 | cytoplasm | IBA | -- |
| GO:0005829 | cytosol | TAS | -- |
| GO:0070062 | extracellular exosome | HDA,IDA | 19056867 |
Pathways & Interactions for TAOK1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Cell Cycle, Mitotic |
.83
|
.60
|
| 2 | Mitotic Metaphase and Anaphase |
.94
|
|
| 3 | Mitotic Prometaphase | ||
| 4 | MAPK signaling pathway | ||
| 5 | Signaling by Rho GTPases | ||
Pathways by source for TAOK1 Gene
2 BioSystems pathways for TAOK1 Gene
12 Reactome pathways for TAOK1 Gene
1 KEGG pathway for TAOK1 Gene
Interacting Proteins for TAOK1 Gene
Selected Interacting proteins:
Q7L7X3-TAOK1_HUMAN
ENSP00000261716
for TAOK1 Gene via
MINT
STRING
IID
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000186 | activation of MAPKK activity | IEA | -- |
| GO:0000187 | activation of MAPK activity | TAS | 22683681 |
| GO:0006281 | DNA repair | IEA | -- |
| GO:0006468 | protein phosphorylation | NAS | 14517247 |
| GO:0006915 | apoptotic process | IEA | -- |
Drugs & Compounds for TAOK1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| ATP | Investigational | Nutra | Agonist | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
Transcripts for TAOK1 Gene
mRNA/cDNA for TAOK1 Gene
- (3) REFSEQ mRNAs :
- (15) Additional mRNA sequences :
- (82) Selected AceView cDNA sequences:
- (6) Ensembl transcripts including schematic representations, and UCSC links where relevant :
CRISPR Products
-
OriGene CRISPR knockouts for TAOK1
- genomics-online: gRNA clones - Search results for available TAOK1 gene related products
- Applied Biological Materials CRISPR for TAOK1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
- GenScript: Design CRISPR guide RNA sequences for TAOK1
miRNA Products
- Search ViGene Biosciences for TAOK1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- genomics-online: shRNA clones - Search results for available TAOK1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for TAOK1 gene
Clone Products
- VectorBuilder custom plasmid, inducible vectors for TAOK1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for TAOK1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- genomics-online: cdna clones - Search results for available TAOK1 gene related products
- orf clones - Search results for available TAOK1 gene related products
- Applied Biological Materials Clones for TAOK1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1 | ^ | 2a | · | 2b | ^ | 3 | ^ | 4a | · | 4b | · | 4c | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9a | · | 9b | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19 | ^ | 20 | ^ | 21 | ^ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - |
| ExUns: | 22 |
|---|---|
| SP1: | |
| SP2: | |
| SP3: | |
| SP4: |
Expression for TAOK1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Blood (Hematopoietic System)
- Proerythroblasts Hematopoietic Bone Marrow
- pre Conventional Dendritic Cells Peripheral Blood
- Double Positive Thymocytes Thymus
-
Thymus (Hematopoietic System)
- Double Positive Thymocytes Thymus
- Eye (Sensory Organs)
This gene is overexpressed in Peripheral blood mononuclear cells (35.1).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TAOK1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of TAOK1 Gene:
TAOK1SOURCE GeneReport for Unigene cluster for TAOK1 Gene:
Hs.597434mRNA Expression by UniProt/SwissProt for TAOK1 Gene:
Q7L7X3-TAOK1_HUMAN
Tissue specificity:
Highly expressed in the testis, and to a lower extent also expressed in brain, placenta, colon and skeletal muscle.
Evidence on tissue expression from TISSUES for TAOK1 Gene
- Nervous system(4.8)
- Blood(4.3)
- Liver(4.3)
- Lung(2.3)
Primer Products
-
OriGene qPCR primer pairs for TAOK1
- genomics-online: primer clones - Search results for available TAOK1 gene related products
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for TAOK1 Gene
Orthologs for TAOK1 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | TAOK1 33 34 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | TAOK1 34 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | TAOK1 34 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | TAOK1 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | TAOK1 33 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Taok1 33 |
|
||
| mouse (Mus musculus) |
Mammalia | Taok1 33 16 34 |
|
||
| chicken (Gallus gallus) |
Aves | TAOK1 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | TAOK1 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | taok1 33 |
|
||
| Str.6620 33 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | MGC52943 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | TAOK1 (2 of 3) 34 |
|
OneToMany | |
| taok1 34 |
|
OneToMany | |||
| CU929119.2 34 |
|
OneToMany | |||
| LOC100004576 33 |
|
||||
| fruit fly (Drosophila melanogaster) |
Insecta | Tao 33 34 |
|
||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP003202 33 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | kin-18 33 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 34 |
|
OneToMany | |
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.8830 33 |
|
- Species where no ortholog for TAOK1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for TAOK1 Gene
Variants for TAOK1 Gene
| SNP ID | Clin | Chr 17 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000013501 | -- | 29,418,288(+) | A/G | intron_variant | |
| rs1000047173 | -- | 29,425,133(+) | G/A | intron_variant | |
| rs1000050318 | -- | 29,525,382(+) | ATTACA/A | intron_variant | |
| rs1000065096 | -- | 29,437,932(+) | T/C | intron_variant | |
| rs1000068118 | -- | 29,410,524(+) | A/G | intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv22895 | CNV | loss | 19812545 |
| esv2335781 | CNV | deletion | 18987734 |
| esv2474903 | CNV | deletion | 19546169 |
| esv2658989 | CNV | deletion | 23128226 |
| esv2673792 | CNV | deletion | 23128226 |
| esv2715797 | CNV | deletion | 23290073 |
| esv3303028 | CNV | tandem duplication | 20981092 |
| esv3405501 | CNV | insertion | 20981092 |
| esv3582597 | CNV | loss | 25503493 |
| esv3640327 | CNV | loss | 21293372 |
| esv994280 | OTHER | inversion | 20482838 |
| nsv1077840 | CNV | duplication | 25765185 |
| nsv819892 | CNV | loss | 19587683 |
| nsv821292 | CNV | duplication | 20802225 |
| nsv827940 | CNV | gain | 20364138 |
| nsv833409 | CNV | gain | 17160897 |
Residual Variation Intolerance Score:
4.52% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.48;
28.86% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for TAOK1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- TAOK1
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TAOK1 Gene
Disorders for TAOK1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| chromosome 17q11.2 deletion syndrome, 1.4-mb |
|
|
Search TAOK1 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for TAOK1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for TAOK1 Gene
Publications for TAOK1 Gene
- Human TAO kinase 1 induces apoptosis in SH-SY5Y cells. (PMID: 17900936) Wu MF … Wang SG (Cell biology international 2008) 3 4 22 58
- A functional genomic screen identifies a role for TAO1 kinase in spindle-checkpoint signalling. (PMID: 17417629) Draviam VM … Elledge SJ (Nature cell biology 2007) 3 4 22 58
- MARKK, a Ste20-like kinase, activates the polarity-inducing kinase MARK/PAR-1. (PMID: 14517247) Timm T … Mandelkow EM (The EMBO journal 2003) 2 3 22 58
- Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10718198) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 2000) 2 3 4 58
- New gene functions in megakaryopoiesis and platelet formation. (PMID: 22139419) Gieger C … Soranzo N (Nature 2011) 3 44 58
Products for TAOK1 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for TAOK1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for TAOK1
- Search Origene for MassSpec and Protein Over-expression Lysates for TAOK1
- Origene Custom Protein Services for TAOK1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for TAOK1
- Browse OriGene Inhibitory RNA Products For TAOK1
- OriGene qPCR primer pairs for TAOK1
- OriGene CRISPR knockouts for TAOK1
- OriGene ORF clones in human for TAOK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For TAOK1
- GenScript: Next-day shipping of latest version cDNA ORF clones for TAOK1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for TAOK1
- GenScript Custom Assay Services for TAOK1
- GenScript Custom overexpressing Cell Line Services for TAOK1
- GenScript: Design CRISPR guide RNA sequences for TAOK1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for TAOK1
- Browse Sino Biological cDNA Clones
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for TAOK1
- Novus Biologicals lysates and proteins for TAOK1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for TAOK1
- Abcam proteins for TAOK1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Taconic Biosciences Mouse Models for TAOK1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for TAOK1
- Cyagen custom Knockout/knockin (KOKI) mouse models for TAOK1
- VectorBuilder custom plasmid, inducible vectors for TAOK1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for TAOK1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 141 available TAOK1 Antibodies ranked by validation data
- Compare Top TAOK1 Antibodies
- Quality Products:
- antibodies-online: Search results for 4 available TAOK1 Elisa Kits ranked by validation data
- Compare Top TAOK1 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 5 available TAOK1 Proteins ranked by validation data
- Compare Top TAOK1 Proteins
- Quality Products:
- Search GeneTex for Antibodies for TAOK1
- Search GeneTex for Proteins for TAOK1
- ViGene Biosciences adenoviral particle packaged cDNA for TAOK1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for TAOK1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for TAOK1 gene
- Search ViGene Biosciences for TAOK1
- Santa Cruz Biotechnology (SCBT) Antibodies for TAOK1
- Search Santa Cruz Biotechnology (SCBT) for TAOK1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for TAOK1
- Horizon Cell Lines for TAOK1
- genomics-online: cdna clones - Search results for available TAOK1 gene related products
- orf clones - Search results for available TAOK1 gene related products
- genomics-online: gRNA clones - Search results for available TAOK1 gene related products
- genomics-online: primer clones - Search results for available TAOK1 gene related products
- genomics-online: shRNA clones - Search results for available TAOK1 gene related products
Sources for TAOK1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems