Free for academic non-profit institutions. Other users need a Commercial license
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in... See more...
Aliases for ST8SIA1 Gene
Aliases for ST8SIA1 Gene
- ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 1 2 3 5
- Sialyltransferase 8 (Alpha-N-Acetylneuraminate: Alpha-2,8-Sialytransferase, GD3 Synthase) A 2 3
- ST8 Alpha-N-Acetylneuraminate Alpha-2,8-Sialyltransferase 1 2 3
- Alpha-N-Acetylneuraminide Alpha-2,8-Sialyltransferase 3 4
- Alpha-2,8-Sialyltransferase 8A 3 4
- Sialyltransferase St8Sia I 3 4
- Ganglioside GD3 Synthase 3 4
- Ganglioside GT3 Synthase 3 4
- EC 2.4.99.8 4 51
- SIAT8-A 3 4
External Ids for ST8SIA1 Gene
- HGNC: 10869
- Entrez Gene: 6489
- Ensembl: ENSG00000111728
- OMIM: 601123
- UniProtKB: Q92185
Previous HGNC Symbols for ST8SIA1 Gene
- SIAT8
- SIAT8A
Previous GeneCards Identifiers for ST8SIA1 Gene
- GC12M022246
- GC12M022119
Summaries for ST8SIA1 Gene
-
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2015]
GeneCards Summary for ST8SIA1 Gene
ST8SIA1 (ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 1) is a Protein Coding gene. Diseases associated with ST8SIA1 include Miller Fisher Syndrome. Among its related pathways are Transport to the Golgi and subsequent modification and Glycosphingolipid biosynthesis - ganglio series. Gene Ontology (GO) annotations related to this gene include sialyltransferase activity and alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity. An important paralog of this gene is ST8SIA6.
UniProtKB/Swiss-Prot Summary for ST8SIA1 Gene
-
Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid.
Additional gene information for ST8SIA1 Gene
- HGNC(10869)
- Entrez Gene(6489)
- Ensembl(ENSG00000111728)
- OMIM(601123)
- UniProtKB(Q92185)
- Open Targets Platform(ENSG00000111728)
- Monarch Initiative
- Search for ST8SIA1 at DataMed
- Search for ST8SIA1 at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ST8SIA1 Gene
Genomics for ST8SIA1 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for ST8SIA1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around ST8SIA1 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ST8SIA1
- Top Transcription factor binding sites by QIAGEN in the ST8SIA1 gene promoter:
-
- C/EBPalpha
- CUTL1
- Gfi-1
- GR
- GR-alpha
- HOXA9
- HOXA9B
- Meis-1
- Meis-1b
- RORalpha1
Genomic Locations for ST8SIA1 Gene
Genomic Locations for ST8SIA1 Gene
- chr12:22,063,773-22,437,041
- (GRCh38/hg38)
- Size:
- 373,269 bases
- Orientation:
- Minus strand
- chr12:22,216,707-22,589,975
- (GRCh37/hg19)
- Size:
- 373,269 bases
- Orientation:
- Minus strand
Genomic View for ST8SIA1 Gene
Genes around ST8SIA1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 12p12.1 by HGNC
- 12p12.1 by Entrez Gene
- 12p12.1 by Ensembl
ST8SIA1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ST8SIA1 Gene
Proteins for ST8SIA1 Gene
-
Protein details for ST8SIA1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q92185-SIA8A_HUMAN
- Recommended name:
- Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
- Protein Accession:
- Q92185
- A8K4H6
- Q17RL0
- Q6PZN5
- Q93064
Protein attributes for ST8SIA1 Gene
- Size:
- 356 amino acids
- Molecular mass:
- 40519 Da
- Quaternary structure:
- No Data Available
- SequenceCaution:
-
- Sequence=AAC37586.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAA54891.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Protein Expression for ST8SIA1 Gene
Selected DME Specific Peptides for ST8SIA1 Gene
- Q92185:
-
- PSLRVYYTL
- WPFSVNM
- HAMPEEFLQLW
- LYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILK
- GKFWKSRGIH
- PISHHYYDNVLPF
Post-translational modifications for ST8SIA1 Gene
Other Protein References for ST8SIA1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- BioLegend Purified anti-GD3 (MEL-1)
- Novus Biologicals Antibodies for ST8SIA1
-
Abcam antibodies for ST8SIA1
- Invitrogen Antibodies for ST8SIA1 (AFLGC-ST8SIA1)
-
Santa Cruz Biotechnology (SCBT) Antibodies for ST8SIA1
Protein Products
-
OriGene Purified Proteins for ST8SIA1
- Search Origene for MassSpec and Protein Over-expression Lysates for ST8SIA1
- Origene Custom Protein Services for ST8SIA1
- Sino Biological Cell Lysates for ST8SIA1
- Sino Biological Recombinant Proteins for ST8SIA1
- antibodies-online: Show 9 available ST8SIA1 Proteins ranked by validation data
- Compare Top ST8SIA1 Proteins
-
Quality Products:
-
Signalway Proteins for ST8SIA1
-
ProSci Proteins for ST8SIA1
-
Abcam proteins for ST8SIA1
Assay Products
- RayBiotech Custom Human ST8SIA1 ELISA
- antibodies-online: Show 3 available ST8SIA1 Elisa Kits ranked by validation data
- Compare Top ST8SIA1 Elisa Kits
-
Quality Products:
Domains & Families for ST8SIA1 Gene
Gene Families for ST8SIA1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for ST8SIA1 Gene
- InterPro:
- Blocks:
-
- Glycosyl transferase, family 29
- ProtoNet:
Suggested Antigen Peptide Sequences for ST8SIA1 Gene
- GenScript: Design optimal peptide antigens:
-
- Sialytransferase St8Sia I (SIA8A_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q92185- Family:
-
- Belongs to the glycosyltransferase 29 family.
Function for ST8SIA1 Gene
Molecular function for ST8SIA1 Gene
- UniProtKB/Swiss-Prot Function:
- Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+); Xref=Rhea:RHEA:19313, ChEBI:CHEBI:15378, ChEBI:CHEBI:57812, ChEBI:CHEBI:60377, ChEBI:CHEBI:140308, ChEBI:CHEBI:140309; EC=2.4.99.8; Evidence={ECO:0000269|PubMed:7937974, ECO:0000269|PubMed:8058740, ECO:0000269|PubMed:8195250, ECO:0000269|PubMed:8631981};.
Enzyme Numbers (IUBMB) for ST8SIA1 Gene
Phenotypes From GWAS Catalog for ST8SIA1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003828 | alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity | IEA,IBA | 21873635 |
| GO:0008373 | sialyltransferase activity | IEA,TAS | 8195250 |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
Phenotypes for ST8SIA1 Gene
- MGI mutant phenotypes for ST8SIA1:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for ST8SIA1:
-
- Increased vaccinia virus (VACV) infection
- no effect
- Decreased viability
- Strongly decreased CFP-tsO45G cell surface transport
- Decreased NF-kappaB reporter expression
- Increased shRNA abundance (Z-score > 2)
- Negative genetic interaction between PTTG1-/- and PTTG1+/+
- Decreased infection with West Nile virus (WNV)
- Decreased West Nile virus (WNV) infection
- Negative genetic interaction between PTEN-/- and PTEN+/+
- Decreased shRNA abundance (Z-score < -2)
- Increased G2M DNA content
Animal Models for ST8SIA1 Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ST8SIA1 - Select products 50% OFF >
- * ST8SIA1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for ST8SIA1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ST8SIA1
-
Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
miRNA for ST8SIA1 Gene
- miRTarBase miRNAs that target ST8SIA1
-
- mmu-miR-3572-3p (MIRT580706)
- mmu-miR-741-3p (MIRT593014)
- mmu-miR-466l-5p (MIRT593136)
- mmu-miR-466i-5p (MIRT593137)
- mmu-miR-466d-5p (MIRT593138)
- mmu-miR-466k (MIRT593139)
- mmu-miR-376c-3p (MIRT593140)
- mmu-miR-1943-5p (MIRT602969)
- mmu-miR-882 (MIRT602970)
- mmu-miR-3473a (MIRT602971)
- mmu-miR-185-5p (MIRT602972)
- mmu-miR-466o-3p (MIRT606741)
- mmu-miR-466m-3p (MIRT606742)
- mmu-miR-466n-3p (MIRT606743)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ST8SIA1
Clone Products
- Applied Biological Materials (abm): Clones for ST8SIA1 - Select products 50% OFF >
- * ST8SIA1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for ST8SIA1
- Addgene plasmids for ST8SIA1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ST8SIA1
Cell Line Products
-
Horizon Cell Lines for ST8SIA1
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ST8SIA1 Gene
Localization for ST8SIA1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ST8SIA1 Gene
- Golgi apparatus membrane. Single-pass type II membrane protein.
| Compartment | Confidence |
|---|---|
| golgi apparatus | 5 |
| plasma membrane | 2 |
| extracellular | 2 |
| mitochondrion | 2 |
| nucleus | 2 |
| endoplasmic reticulum | 2 |
| lysosome | 2 |
| cytoskeleton | 1 |
| endosome | 1 |
| cytosol | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | TAS | -- |
| GO:0005794 | Golgi apparatus | IEA | -- |
| GO:0016020 | membrane | IEA | -- |
| GO:0016021 | integral component of membrane | IEA | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for ST8SIA1 Gene
Pathways & Interactions for ST8SIA1 Gene
Pathways by source for ST8SIA1 Gene
2 BioSystems pathways for ST8SIA1 Gene
UniProtKB/Swiss-Prot Q92185-SIA8A_HUMAN
- Pathway: Protein modification; protein glycosylation.
- Pathway: Lipid metabolism; sphingolipid metabolism.
Interacting Proteins for ST8SIA1 Gene
GPS-Prot Interaction Network for ST8SIA1
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005975 | carbohydrate metabolic process | TAS | 8195250 |
| GO:0006486 | protein glycosylation | IEA | -- |
| GO:0006491 | N-glycan processing | IBA | 21873635 |
| GO:0006629 | lipid metabolic process | IEA | -- |
| GO:0006665 | sphingolipid metabolic process | IEA | -- |
No data available for SIGNOR curated interactions for ST8SIA1 Gene
Drugs & Compounds for ST8SIA1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Cytidine monophosphate | Experimental | Pharma | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Cytidine monophosphate N-acetylneuraminic acid |
|
22-12-8 |
|
|||
| Ganglioside GD3 (d18:1/12:0) |
|
|
||||
| Ganglioside GD3 (d18:1/16:0) |
|
|
||||
| Ganglioside GD3 (d18:1/18:0) |
|
|
||||
| Ganglioside GD3 (d18:1/20:0) |
|
|
Transcripts for ST8SIA1 Gene
mRNA/cDNA for ST8SIA1 Gene
- 2 REFSEQ mRNAs :
- 15 NCBI additional mRNA sequence :
- 15 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000261197 1996 nts (view in UCSC)
- ENST00000381424 1036 nts (view in UCSC)
- ENST00000396037 9714 nts (view in UCSC)
- ENST00000404299 1920 nts (view in UCSC)
- ENST00000508924 565 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ST8SIA1 - Select products 50% OFF >
- * ST8SIA1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for ST8SIA1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ST8SIA1
-
Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ST8SIA1
Clone Products
- Applied Biological Materials (abm): Clones for ST8SIA1 - Select products 50% OFF >
- * ST8SIA1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for ST8SIA1
- Addgene plasmids for ST8SIA1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ST8SIA1
| ExUns: | 1a | · | 1b | · | 1c | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | · | 7c | · | 7d |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||||||||
| SP2: | - | - | - | - | |||||||||||||||||||||
| SP3: | |||||||||||||||||||||||||
| SP4: | - | ||||||||||||||||||||||||
| SP5: |
Relevant External Links for ST8SIA1 Gene
- GeneLoc Exon Structure for
- ST8SIA1
Expression for ST8SIA1 Gene
mRNA differential expression in normal tissues according to GTEx for ST8SIA1 Gene
This gene is overexpressed in Brain - Cerebellum (x4.0) and Brain - Cerebellar Hemisphere (x4.0).
This gene is overexpressed in Plasma (42.0) and Heart (27.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for ST8SIA1 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ST8SIA1
SOURCE GeneReport for Unigene cluster for ST8SIA1 Gene:
Hs.408614mRNA Expression by UniProt/SwissProt for ST8SIA1 Gene:
Q92185-SIA8A_HUMAN
Tissue specificity:
Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung.
Evidence on tissue expression from TISSUES for ST8SIA1 Gene
- Intestine(4.4)
- Stomach(4.3)
- Nervous system(2.7)
- Lymph node(2.1)
- Liver(2)
Primer Products
-
OriGene qPCR primer pairs for ST8SIA1
-
OriGene qPCR primer pairs and template standards for ST8SIA1
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for ST8SIA1 Gene
Orthologs for ST8SIA1 Gene
This gene was present in the common ancestor of chordates.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | ST8SIA1 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | ST8SIA1 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | ST8SIA1 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | St8sia1 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | St8sia1 30 |
|
||
| Oppossum (Monodelphis domestica) |
Mammalia | ST8SIA1 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | ST8SIA1 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | ST8SIA1 31 |
|
OneToOne | |
| African clawed frog (Xenopus laevis) |
Amphibia | LOC398735 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | LOC100333872 30 |
|
||
| st8sia1 31 31 |
|
OneToMany |
- Species where no ortholog for ST8SIA1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Fruit Fly (Drosophila melanogaster)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Platypus (Ornithorhynchus anatinus)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Squirt (Ciona savignyi)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Tropical Clawed Frog (Silurana tropicalis)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
Evolution for ST8SIA1 Gene
- ENSEMBL:
- Gene Tree for ST8SIA1 (if available)
- TreeFam:
- Gene Tree for ST8SIA1 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for ST8SIA1: view image
Paralogs for ST8SIA1 Gene
(8) SIMAP similar genes for ST8SIA1 Gene using alignment to 7 proteins:
- SIA8A_HUMAN
- F8WCS8_HUMAN
- G3V1U7_HUMAN
- H0YFU1_HUMAN
- H0YG41_HUMAN
- H0YGV9_HUMAN
- Q86X71_HUMAN
Variants for ST8SIA1 Gene
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv467e212 | CNV | loss | 25503493 |
| esv23565 | CNV | loss | 19812545 |
| esv2759883 | CNV | gain+loss | 17122850 |
| esv3304736 | CNV | mobile element insertion | 20981092 |
| esv33913 | CNV | gain | 17666407 |
| esv3435731 | CNV | insertion | 20981092 |
| esv3580188 | CNV | loss | 25503493 |
| nsv1070516 | CNV | deletion | 25765185 |
| nsv1119938 | CNV | deletion | 24896259 |
| nsv1119939 | CNV | deletion | 24896259 |
| nsv1130908 | CNV | deletion | 24896259 |
| nsv1146956 | CNV | deletion | 26484159 |
| nsv435637 | CNV | deletion | 17901297 |
| nsv476720 | CNV | novel sequence insertion | 20440878 |
| nsv482978 | CNV | loss | 15286789 |
| nsv521274 | CNV | loss | 19592680 |
Residual Variation Intolerance Score:
37.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.96;
19.81% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for ST8SIA1 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ST8SIA1 Gene
Disorders for ST8SIA1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| miller fisher syndrome |
|
|
Search ST8SIA1 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for ST8SIA1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for ST8SIA1 Gene
Publications for ST8SIA1 Gene
- Variants in ST8SIA1 do not play a major role in susceptibility to multiple sclerosis in Canadian families. (PMID: 19428123) Ramagopalan SV … Ebers GC (Journal of neuroimmunology 2009) 3 23 41
- Variants of ST8SIA1 are associated with risk of developing multiple sclerosis. (PMID: 18612409) Husain S … Vitale E (PloS one 2008) 3 23 41
- Isolation of GD3 synthase gene by expression cloning of GM3 alpha-2,8-sialyltransferase cDNA using anti-GD2 monoclonal antibody. (PMID: 7937974) Haraguchi M … Furukawa K (Proceedings of the National Academy of Sciences of the United States of America 1994) 3 4 23
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41
- Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease. (PMID: 20708005) Chalasani N … Nonalcoholic Steatohepatitis Clinical Research Network (Gastroenterology 2010) 3 41
ExternalLinks
Products for ST8SIA1 Gene
- View all 2 R&D Systems ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1") Products
- View all R&D Systems ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1") Proteins and Enzymes
- View all R&D Systems ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1") Primary Antibodies
- Learn more about R&D Systems custom ST8SIA1 antibody, protein, and immunoassay development services
- Browse OriGene Antibodies
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ST8SIA1
- Search Origene for MassSpec and Protein Over-expression Lysates for ST8SIA1
- Origene Custom Protein Services for ST8SIA1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
- OriGene qPCR primer pairs for ST8SIA1
- OriGene qPCR primer pairs and template standards for ST8SIA1
- OriGene CRISPR knockouts for ST8SIA1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ST8SIA1
- Sino Biological Human cDNA Clone for ST8SIA1
- Sino Biological Cell Lysates for ST8SIA1
- Sino Biological Recombinant Proteins for ST8SIA1
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Recombinant Proteins
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for ST8SIA1
- Novus Biologicals proteins and lysates for ST8SIA1
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for ST8SIA1
- Abcam proteins for ST8SIA1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for ST8SIA1 (AFLGC-ST8SIA1)
- VectorBuilder Custom and pre-made DNA vectors for ST8SIA1 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for ST8SIA1 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for ST8SIA1 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for ST8SIA1 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for ST8SIA1
- Addgene plasmids for ST8SIA1
- antibodies-online: Show 18 available ST8SIA1 Antibodies ranked by validation data
- Compare Top ST8SIA1 Antibodies
- antibodies-online: Show 3 available ST8SIA1 Elisa Kits ranked by validation data
- Compare Top ST8SIA1 Elisa Kits
- Quality Products:
- antibodies-online: Show 9 available ST8SIA1 Proteins ranked by validation data
- Compare Top ST8SIA1 Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for ST8SIA1
- Search Santa Cruz Biotechnology (SCBT) for ST8SIA1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
- Horizon Cell Lines for ST8SIA1
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ST8SIA1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ST8SIA1
- Search GeneCopoeia for miRNA 3'UTR Target clone products for ST8SIA1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ST8SIA1
- Signalway Proteins for ST8SIA1
Sources for ST8SIA1 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB