Free for academic non-profit institutions. Other users need a Commercial license
Aliases for SLK Gene
Aliases for SLK Gene
- HSLK 3 4
- SNF1 (Sucrose Nonfermenting, Yeast, Homolog)-Like Kinase, SNF1 Sucrose Nonfermenting Like Kinase (Yeast) 2
- SNF1 (Sucrose Nonfermenting, Yeast, Homolog)-Like Kinase, SNF1 Sucrose Nonfermenting Like Kinase 3
- SNF1 Sucrose Nonfermenting Like Kinase 3
- Ste20-Related Serine/Threonine Kinase 3
- STE20-Like Kinase (Yeast) 2
- Long Ste20-Like Kinase 3
- BA16H23.1 3
- EC 2.7.11 51
- LOSK 3
- SLK 5
External Ids for SLK Gene
- HGNC: 11088
- Entrez Gene: 9748
- Ensembl: ENSG00000065613
- OMIM: 616563
- UniProtKB: Q9H2G2
Previous GeneCards Identifiers for SLK Gene
- GC10P104620
- GC00U905130
- GC10P105392
- GC10P105716
- GC10P099381
Summaries for SLK Gene
GeneCards Summary for SLK Gene
SLK (STE20 Like Kinase) is a Protein Coding gene. Diseases associated with SLK include Advanced Sleep Phase Syndrome, Familial, 3 and Advanced Sleep Phase Syndrome, Familial, 1. Among its related pathways are Oocyte meiosis and Adhesion. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is STK10.
UniProtKB/Swiss-Prot Summary for SLK Gene
-
Mediates apoptosis and actin stress fiber dissolution.
Additional gene information for SLK Gene
- HGNC(11088)
- Entrez Gene(9748)
- Ensembl(ENSG00000065613)
- OMIM(616563)
- UniProtKB(Q9H2G2)
- Open Targets Platform(ENSG00000065613)
- Search for SLK at DataMed
- Search for SLK at HumanCyc
No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for SLK Gene
Genomics for SLK Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for SLK Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around SLK on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for SLK
- Top Transcription factor binding sites by QIAGEN in the SLK gene promoter:
-
- AP-1
- ATF-2
- c-Jun
- c-Myc
- E4BP4
- GR
- GR-alpha
- Max
- USF-1
- USF1
Genomic Locations for SLK Gene
Genomic Locations for SLK Gene
- chr10:103,967,100-104,029,233
- (GRCh38/hg38)
- Size:
- 62,134 bases
- Orientation:
- Plus strand
- chr10:105,726,959-105,788,991
- (GRCh37/hg19)
- Size:
- 62,033 bases
- Orientation:
- Plus strand
Genomic View for SLK Gene
Genes around SLK on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 10q24.33-q25.1 by HGNC
- 10q24.33-q25.1 by Entrez Gene
- 10q24.33 by Ensembl
SLK Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for SLK Gene
Proteins for SLK Gene
-
Protein details for SLK Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9H2G2-SLK_HUMAN
- Recommended name:
- STE20-like serine/threonine-protein kinase
- Protein Accession:
- Q9H2G2
- D3DRA0
- D3DRA1
- O00211
- Q6P1Z4
- Q86WU7
- Q86WW1
- Q92603
- Q9NQL0
- Q9NQL1
Protein attributes for SLK Gene
- Size:
- 1235 amino acids
- Molecular mass:
- 142695 Da
- Quaternary structure:
- No Data Available
- SequenceCaution:
-
- Sequence=AAH47762.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 611.; Evidence={ECO:0000305}; Sequence=AAH47885.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 422.; Evidence={ECO:0000305}; Sequence=AAH64804.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 614.; Evidence={ECO:0000305}; Sequence=BAA13195.2; Type=Frameshift; Evidence={ECO:0000305};
Three dimensional structures from OCA and Proteopedia for SLK Gene
Protein Expression for SLK Gene
Selected DME Specific Peptides for SLK Gene
- Q9H2G2:
-
- FIGTPYWMAPEV
- IIHRDLKA
- DLNLSISSFLSK
- GTPYWMAPEVV
- LLVEHETQKLK
- LLQHPFVT
- QLQNEKC
- WSSNFKDFL
- EQMQRYNQR
- ARLPKIQRS
- LKKIIQQQKAELANIERECLNNKQQL
- IEPPHHELNPMRVLLKIAKS
- KQQLKDQYF
- GTPYWMAPE
- GELGDGAFGKVYKA
- KLRPRKK
- VLAAAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDA
Post-translational modifications for SLK Gene
- Proteolytically cleaved by caspase-3.
- Autophosphorylated.
-
Ubiquitination at Lys179
- NX_Q9H2G2 (NX_Q9H2G2-1)
- Modification sites at PhosphoSitePlus
Other Protein References for SLK Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- LifeSpan BioSciences SLK Antibody (LS-B8528) and SLK Antibody (LS-B13410)
- G Biosciences Immunotag™ SLK Antibody
- NSJ Bioreagents SLK Antibody / STE20-like kinase
-
Custom Antibody ServicesOriGene Antibodies for SLK
- Novus Biologicals Antibodies for SLK
-
Abcam antibodies for SLK
- Invitrogen Antibodies for SLK (AFLGC-SLK)
-
Boster Bio Antibodies for SLK
-
Santa Cruz Biotechnology (SCBT) Antibodies for SLK
- Sino Biological Antibodies for SLK
Protein Products
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for SLK
- Origene Custom Protein Services for SLK
- Novus Biologicals proteins for SLK
- antibodies-online: Show 6 available SLK Proteins ranked by validation data
- Compare Top SLK Proteins
-
Quality Products:
-
Abcam proteins for SLK
Assay Products
- antibodies-online: Show 6 available SLK Elisa Kits ranked by validation data
- Compare Top SLK Elisa Kits
-
Quality Products:
-
Signalway ELISA kits for SLK
Domains & Families for SLK Gene
Gene Families for SLK Gene
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for SLK Gene
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for SLK Gene
- GenScript: Design optimal peptide antigens:
-
- Serine/threonine-protein kinase 2 (SLK_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9H2G2UniProtKB/Swiss-Prot:
SLK_HUMAN :- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Function for SLK Gene
Molecular function for SLK Gene
- UniProtKB/Swiss-Prot Function:
- Mediates apoptosis and actin stress fiber dissolution.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.
Enzyme Numbers (IUBMB) for SLK Gene
Phenotypes From GWAS Catalog for SLK Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0004672 | protein kinase activity | IEA | -- |
| GO:0004674 | protein serine/threonine kinase activity | IBA,IDA | 18239682 |
| GO:0005515 | protein binding | IPI | 25882817 |
| GO:0005524 | ATP binding | IEA | -- |
Phenotypes for SLK Gene
- MGI mutant phenotypes for SLK:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for SLK:
-
- no effect
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased viability with MLN4924 (a NAE inhibitor)
- Decreased viability ratio
- Decreased viability in non-small-cell lung cancer (NSCLC) lineage
- Increased viability (proliferation)
- Strongly decreased CFP-tsO45G cell surface transport
- Increased transferrin (TF) endocytosis
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Decreased shRNA abundance (Z-score < -2)
- Increased cell migration
- Decreased substrate adherent cell growth
- Decreased vesicular stomatitis virus (VSV) infection
- Decreased senescence-associated beta-galactosidase protein expression after pRB stimulation
- Transferrin accumulation in the perinuclear area
Animal Model Products
-
Taconic Biosciences Mouse Models for SLK
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for SLK - Select products 50% OFF >
- * SLK CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for SLK
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for SLK
-
Santa Cruz Biotechnology (SCBT) CRISPR for SLK
miRNA for SLK Gene
- miRTarBase miRNAs that target SLK
-
- mmu-miR-297a-5p (MIRT012927)
- hsa-miR-21-5p (MIRT031072)
- hsa-miR-615-3p (MIRT040336)
- hsa-miR-484 (MIRT042026)
- hsa-let-7c-5p (MIRT051774)
- hsa-miR-20a-5p (MIRT439590)
- hsa-miR-106b-5p (MIRT439592)
- hsa-miR-519d-3p (MIRT726495)
- hsa-miR-93-5p (MIRT726496)
- hsa-miR-20b-5p (MIRT726497)
- hsa-miR-17-5p (MIRT726498)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for SLK
- Browse OriGene Inhibitory RNA Products For SLK
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for SLK
Clone Products
- Applied Biological Materials (abm): Clones for SLK - Select products 50% OFF >
- * SLK as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for SLK
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for SLK
Cell Line Products
-
Horizon Cell Lines for SLK
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for SLK Gene
Localization for SLK Gene
Subcellular locations from UniProtKB/Swiss-Prot for SLK Gene
- Cytoplasm.
| Compartment | Confidence |
|---|---|
| extracellular | 4 |
| cytosol | 4 |
| plasma membrane | 3 |
| nucleus | 3 |
| cytoskeleton | 2 |
| mitochondrion | 2 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| endosome | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Cytosol (2)
- Plasma membrane (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005737 | cytoplasm | IBA,IDA | 18287541 |
| GO:0031252 | cell leading edge | ISS | -- |
| GO:0048471 | perinuclear region of cytoplasm | IDA | 26094769 |
| GO:0070062 | extracellular exosome | HDA | 19056867 |
Pathways & Interactions for SLK Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Adhesion |
-
|
|
| 2 | Apoptosis and Autophagy | ||
| 3 | DNA Damage | ||
| 4 | Oocyte meiosis |
.44
|
|
| 5 | Mitotic Roles of Polo Like Kinases |
Mitotic Roles of Polo Like Kinases
-
|
|
Pathways by source for SLK Gene
1 KEGG pathway for SLK Gene
1 Qiagen pathway for SLK Gene
- Mitotic Roles of Polo Like Kinases
3 Cell Signaling Technology pathways for SLK Gene
Interacting Proteins for SLK Gene
Selected Interacting proteins:
Q9H2G2-SLK_HUMAN
ENSP00000358770
for SLK Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for SLK
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006468 | protein phosphorylation | IEA | -- |
| GO:0006915 | apoptotic process | IEA | -- |
| GO:0007346 | regulation of mitotic cell cycle | IBA | -- |
| GO:0016310 | phosphorylation | IEA | -- |
| GO:0023014 | signal transduction by protein phosphorylation | IBA | -- |
Drugs & Compounds for SLK Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| fostamatinib | Approved, Investigational | Pharma | Target, inhibitor | Kinase Inhibitors | 0 | |
| 2-[4-[4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl]iminocyclohexa-2,5-dien-1-yl]acetonitrile | Experimental | Pharma | Target | 0 | ||
| K-00546 | Experimental | Pharma | Target | 0 | ||
| ATP | Investigational | Nutra | Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist | 58-64-0 |
|
Transcripts for SLK Gene
mRNA/cDNA for SLK Gene
- 2 REFSEQ mRNAs :
- 13 NCBI additional mRNA sequence :
- 4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000335753 7673 nts (view in UCSC)
- ENST00000369755 7827 nts (view in UCSC)
- ENST00000474260 622 nts (view in UCSC)
- ENST00000672560 295 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for SLK - Select products 50% OFF >
- * SLK CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for SLK
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for SLK
-
Santa Cruz Biotechnology (SCBT) CRISPR for SLK
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for SLK
- Browse OriGene Inhibitory RNA Products For SLK
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for SLK
Clone Products
- Applied Biological Materials (abm): Clones for SLK - Select products 50% OFF >
- * SLK as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for SLK
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for SLK
| ExUns: | 1a | · | 1b | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12a | · | 12b | ^ | 13 | ^ | 14 | ^ | 15a | · | 15b | ^ | 16 | ^ | 17 | ^ | 18 | ^ | 19 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | |||||||||||||||||||||||||||||||||||||||||
| SP3: | - |
Relevant External Links for SLK Gene
- GeneLoc Exon Structure for
- SLK
Expression for SLK Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Skeletal Muscle (Muscoskeletal System)
-
Blood (Hematopoietic System)
- Granulocytes Peripheral Blood
-
Esophagus (Gastrointestinal Tract)
This gene is overexpressed in Peripheral blood mononuclear cells (12.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for SLK Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for SLK
SOURCE GeneReport for Unigene cluster for SLK Gene:
Hs.591922mRNA Expression by UniProt/SwissProt for SLK Gene:
Q9H2G2-SLK_HUMAN
Tissue specificity:
Ubiquitously expressed. Highest expression is found in heart and in skeletal muscle.
Evidence on tissue expression from TISSUES for SLK Gene
- Liver(4.5)
- Bone marrow(4.4)
- Kidney(3)
- Heart(2.8)
- Nervous system(2.8)
- Muscle(2.8)
- Blood(2.7)
- Spleen(2.7)
- Skin(2.5)
- Lung(2.5)
- Intestine(2.3)
Primer Products
-
OriGene qPCR primer pairs for SLK
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for SLK Gene
Orthologs for SLK Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | SLK 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | SLK 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | SLK 30 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | SLK 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Slk 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Slk 30 |
|
||
| Oppossum (Monodelphis domestica) |
Mammalia | SLK 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | SLK 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | SLK 31 |
|
OneToOne | |
| Zebrafish (Danio rerio) |
Actinopterygii | slka 30 31 |
|
OneToMany | |
| slkb 31 |
|
OneToMany | |||
| Fruit Fly (Drosophila melanogaster) |
Insecta | CG4527 32 |
|
|
|
| slik 31 |
|
OneToMany | |||
| Worm (Caenorhabditis elegans) |
Secernentea | C04A11.3 32 |
|
|
|
| gck-4 31 |
|
OneToMany | |||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.8272 31 |
|
OneToMany | |
| Sea Vase (Ciona intestinalis) |
Ascidiacea | Cin.14840 30 |
|
- Species where no ortholog for SLK was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Tropical Clawed Frog (Silurana tropicalis)
- Wheat (Triticum aestivum)
Evolution for SLK Gene
- ENSEMBL:
- Gene Tree for SLK (if available)
- TreeFam:
- Gene Tree for SLK (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for SLK: view image
Paralogs for SLK Gene
Paralogs for SLK Gene
(7) SIMAP similar genes for SLK Gene using alignment to 2 proteins:
- SLK_HUMAN
- L8ECF1_HUMAN
Variants for SLK Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for SLK Gene
| SNP ID | Clinical significance and condition | Chr 10 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 770591 | Likely Benign: not provided | 103,992,590(+) | G/T | INTRON_VARIANT | |
| 782292 | Benign: not provided | 104,003,514(+) | C/T | MISSENSE_VARIANT | |
| 801367 | Likely Pathogenic: not provided | 104,019,845(+) | C/T | NONSENSE | |
| 916392 | Uncertain Significance: not provided | 104,003,344(+) | TAAAG/T | FRAMESHIFT_VARIANT | |
| rs190220654 | An ovarian serous carcinoma sample | p.Glu604Gln |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv488e59 | CNV | tandem duplication | 20981092 |
| dgv967n100 | CNV | loss | 25217958 |
| esv3376056 | CNV | duplication | 20981092 |
| esv3413324 | CNV | insertion | 20981092 |
| esv3579098 | CNV | loss | 25503493 |
| esv3624424 | CNV | loss | 21293372 |
| nsv1118186 | CNV | deletion | 24896259 |
| nsv1125510 | CNV | tandem duplication | 24896259 |
| nsv7532 | CNV | insertion | 18451855 |
| nsv951008 | CNV | duplication | 24416366 |
Residual Variation Intolerance Score:
10.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
6.46;
77.40% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for SLK Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for SLK Gene
Disorders for SLK Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| advanced sleep phase syndrome, familial, 3 |
|
|
| advanced sleep phase syndrome, familial, 1 |
|
|
| autoimmune glomerulonephritis |
|
|
Search SLK in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for SLK
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for SLK Gene
Publications for SLK Gene
- Molecular cloning and characterization of a novel human STE20-like kinase, hSLK. (PMID: 10699464) Yamada E … Yamamoto H (Biochimica et biophysica acta 2000) 3 4 23
- Ste20-related protein kinase LOSK (SLK) controls microtubule radial array in interphase. (PMID: 18287541) Burakov AV … Nadezhdina ES (Molecular biology of the cell 2008) 3 23
- A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease. (PMID: 16385451) Grupe A … Goate A (American journal of human genetics 2006) 3 41
- The DNA sequence and comparative analysis of human chromosome 10. (PMID: 15164054) Deloukas P … Rogers J (Nature 2004) 3 4
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
ExternalLinks
Products for SLK Gene
- Custom Antibody ServicesOriGene Antibodies for SLK
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for Purified Proteins, MassSpec and Protein Over-expression Lysates for SLK
- Origene Custom Protein Services for SLK
- Origene shrna, sirna, and RNAi products in human, mouse, rat for SLK
- Browse OriGene Inhibitory RNA Products For SLK
- OriGene qPCR primer pairs for SLK
- OriGene CRISPR knockouts for SLK
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For SLK
- Sino Biological Human cDNA Clone for SLK
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for SLK
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for SLK
- Novus Biologicals proteins for SLK
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for SLK
- Abcam proteins for SLK
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for SLK
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for SLK (AFLGC-SLK)
- VectorBuilder Custom and pre-made DNA vectors for SLK (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for SLK (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for SLK (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for SLK CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for SLK
- antibodies-online: Show 95 available SLK Antibodies ranked by validation data
- Compare Top SLK Antibodies
- antibodies-online: Show 6 available SLK Elisa Kits ranked by validation data
- Compare Top SLK Elisa Kits
- Quality Products:
- antibodies-online: Show 6 available SLK Proteins ranked by validation data
- Compare Top SLK Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for SLK
- Search Santa Cruz Biotechnology (SCBT) for SLK siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for SLK
- Horizon Cell Lines for SLK
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for SLK
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for SLK
- Search GeneCopoeia for miRNA 3'UTR Target clone products for SLK
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for SLK
- Boster Bio Antibodies for SLK
- Browse Boster Bio ELISA Kits
- Signalway ELISA kits for SLK
Sources for SLK Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB