Aliases for SLK Gene

Aliases for SLK Gene

  • STE20 Like Kinase 2 3 5
  • STK2 2 3 4
  • STE20-Related Serine/Threonine-Protein Kinase 3 4
  • STE20-Like Serine/Threonine-Protein Kinase 3 4
  • Serine/Threonine-Protein Kinase 2 3 4
  • CTCL Tumor Antigen Se20-9 3 4
  • STE20-Related Kinase 3 4
  • STE20-Like Kinase 2 4
  • EC 2.7.11.1 4 50
  • KIAA0204 2 4
  • Se20-9 2 3
  • HSLK 3 4
  • SNF1 (Sucrose Nonfermenting, Yeast, Homolog)-Like Kinase, SNF1 Sucrose Nonfermenting Like Kinase (Yeast) 2
  • SNF1 (Sucrose Nonfermenting, Yeast, Homolog)-Like Kinase, SNF1 Sucrose Nonfermenting Like Kinase 3
  • SNF1 Sucrose Nonfermenting Like Kinase 3
  • Ste20-Related Serine/Threonine Kinase 3
  • STE20-Like Kinase (Yeast) 2
  • Long Ste20-Like Kinase 3
  • BA16H23.1 3
  • EC 2.7.11 50
  • LOSK 3
  • SLK 5

External Ids for SLK Gene

Previous GeneCards Identifiers for SLK Gene

  • GC10P104620
  • GC00U905130
  • GC10P105392
  • GC10P105716
  • GC10P099381

Summaries for SLK Gene

GeneCards Summary for SLK Gene

SLK (STE20 Like Kinase) is a Protein Coding gene. Diseases associated with SLK include Advanced Sleep Phase Syndrome, Familial, 3 and Advanced Sleep Phase Syndrome, Familial, 1. Among its related pathways are Mitotic Roles of Polo Like Kinases and Adhesion. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is STK10.

UniProtKB/Swiss-Prot Summary for SLK Gene

Gene Wiki entry for SLK Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for SLK Gene

Genomics for SLK Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for SLK Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around SLK on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for SLK

Top Transcription factor binding sites by QIAGEN in the SLK gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • c-Myc
  • E4BP4
  • GR
  • GR-alpha
  • Max
  • USF-1
  • USF1

Genomic Locations for SLK Gene

Latest Assembly
chr10:103,967,100-104,029,233
(GRCh38/hg38)
Size:
62,134 bases
Orientation:
Plus strand

Previous Assembly
chr10:105,726,898-105,788,991
(GRCh37/hg19 by Entrez Gene)
Size:
62,094 bases
Orientation:
Plus strand

chr10:105,726,959-105,788,991
(GRCh37/hg19 by Ensembl)
Size:
62,033 bases
Orientation:
Plus strand

Genomic View for SLK Gene

Genes around SLK on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
SLK Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for SLK Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for SLK Gene

Proteins for SLK Gene

  • Protein details for SLK Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H2G2-SLK_HUMAN
    Recommended name:
    STE20-like serine/threonine-protein kinase
    Protein Accession:
    Q9H2G2
    Secondary Accessions:
    • D3DRA0
    • D3DRA1
    • O00211
    • Q6P1Z4
    • Q86WU7
    • Q86WW1
    • Q92603
    • Q9NQL0
    • Q9NQL1

    Protein attributes for SLK Gene

    Size:
    1235 amino acids
    Molecular mass:
    142695 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAH47762.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 611.; Evidence={ECO:0000305}; Sequence=AAH47885.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 422.; Evidence={ECO:0000305}; Sequence=AAH64804.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 614.; Evidence={ECO:0000305}; Sequence=BAA13195.2; Type=Frameshift; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for SLK Gene

    Alternative splice isoforms for SLK Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for SLK Gene

Selected DME Specific Peptides for SLK Gene

Q9H2G2:
  • FIGTPYWMAPEV
  • IIHRDLKA
  • DLNLSISSFLSK
  • GTPYWMAPEVV
  • LLVEHETQKLK
  • LLQHPFVT
  • QLQNEKC
  • WSSNFKDFL
  • EQMQRYNQR
  • ARLPKIQRS
  • LKKIIQQQKAELANIERECLNNKQQL
  • IEPPHHELNPMRVLLKIAKS
  • KQQLKDQYF
  • GTPYWMAPE
  • GELGDGAFGKVYKA
  • KLRPRKK
  • VLAAAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDA

Post-translational modifications for SLK Gene

Other Protein References for SLK Gene

Antibodies for research

  • Abcam antibodies for SLK
  • Santa Cruz Biotechnology (SCBT) Antibodies for SLK

Domains & Families for SLK Gene

Gene Families for SLK Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for SLK Gene

GenScript: Design optimal peptide antigens:
  • Serine/threonine-protein kinase 2 (SLK_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9H2G2

UniProtKB/Swiss-Prot:

SLK_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with SLK: view

Function for SLK Gene

Molecular function for SLK Gene

UniProtKB/Swiss-Prot Function:
Mediates apoptosis and actin stress fiber dissolution.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.

Enzyme Numbers (IUBMB) for SLK Gene

Phenotypes From GWAS Catalog for SLK Gene

Gene Ontology (GO) - Molecular Function for SLK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IDA 18239682
GO:0005515 protein binding IPI 25882817
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with SLK: view
genes like me logo Genes that share phenotypes with SLK: view

Animal Models for research

  • Taconic Biosciences Mouse Models for SLK

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for SLK

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for SLK Gene

Localization for SLK Gene

Subcellular locations from UniProtKB/Swiss-Prot for SLK Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for SLK gene
Compartment Confidence
extracellular 4
cytosol 4
plasma membrane 3
nucleus 3
cytoskeleton 2
mitochondrion 2
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Plasma membrane (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for SLK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA,IDA 18287541
GO:0031252 cell leading edge ISS --
GO:0048471 perinuclear region of cytoplasm IDA 26094769
GO:0070062 extracellular exosome HDA 19056867
genes like me logo Genes that share ontologies with SLK: view

Pathways & Interactions for SLK Gene

PathCards logo

SuperPathways for SLK Gene

SuperPathway Contained pathways
1 Adhesion
2 Apoptosis and Autophagy
3 DNA Damage
4 Oocyte meiosis
5 Mitotic Roles of Polo Like Kinases
-
genes like me logo Genes that share pathways with SLK: view

Pathways by source for SLK Gene

1 KEGG pathway for SLK Gene
1 Qiagen pathway for SLK Gene
  • Mitotic Roles of Polo Like Kinases
3 Cell Signaling Technology pathways for SLK Gene

SIGNOR curated interactions for SLK Gene

Activates:
Is inactivated by:

Gene Ontology (GO) - Biological Process for SLK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0006915 apoptotic process IEA --
GO:0016310 phosphorylation IEA --
GO:0030334 regulation of cell migration ISS --
GO:0031122 cytoplasmic microtubule organization IMP 18287541
genes like me logo Genes that share ontologies with SLK: view

Drugs & Compounds for SLK Gene

(5) Drugs for SLK Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
2-[4-[4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl]iminocyclohexa-2,5-dien-1-yl]acetonitrile Experimental Pharma Target 0
K-00546 Experimental Pharma Target 0
ATP Investigational Nutra 0

(2) Additional Compounds for SLK Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
58-64-0
genes like me logo Genes that share compounds with SLK: view

Transcripts for SLK Gene

mRNA/cDNA for SLK Gene

2 REFSEQ mRNAs :
13 NCBI additional mRNA sequence :
4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for SLK

Alternative Splicing Database (ASD) splice patterns (SP) for SLK Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12a · 12b ^ 13 ^ 14 ^ 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19
SP1: -
SP2: - -
SP3: -

Relevant External Links for SLK Gene

GeneLoc Exon Structure for
SLK

Expression for SLK Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for SLK Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for SLK Gene

This gene is overexpressed in Peripheral blood mononuclear cells (12.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for SLK Gene



Protein tissue co-expression partners for SLK Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for SLK

SOURCE GeneReport for Unigene cluster for SLK Gene:

Hs.591922

mRNA Expression by UniProt/SwissProt for SLK Gene:

Q9H2G2-SLK_HUMAN
Tissue specificity: Ubiquitously expressed. Highest expression is found in heart and in skeletal muscle.

Evidence on tissue expression from TISSUES for SLK Gene

  • Liver(4.5)
  • Bone marrow(4.3)
  • Kidney(2.8)
  • Heart(2.7)
  • Nervous system(2.7)
  • Muscle(2.6)
  • Spleen(2.6)
  • Blood(2.6)
  • Lung(2.3)
  • Skin(2.3)
  • Intestine(2.2)
genes like me logo Genes that share expression patterns with SLK: view

Primer products for research

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for SLK Gene

Orthologs for SLK Gene

This gene was present in the common ancestor of animals.

Orthologs for SLK Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia SLK 29 30
  • 99.73 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia SLK 29 30
  • 91.44 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia SLK 29 30
  • 90.35 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia SLK 30
  • 88 (a)
OneToOne
Mouse
(Mus musculus)
Mammalia Slk 29 16 30
  • 84.6 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Slk 29
  • 83.79 (n)
Oppossum
(Monodelphis domestica)
Mammalia SLK 30
  • 79 (a)
OneToOne
Chicken
(Gallus gallus)
Aves SLK 29 30
  • 73.99 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia SLK 30
  • 69 (a)
OneToOne
Zebrafish
(Danio rerio)
Actinopterygii slka 29 30
  • 73.21 (n)
OneToMany
slkb 30
  • 62 (a)
OneToMany
Fruit Fly
(Drosophila melanogaster)
Insecta CG4527 31
  • 40 (a)
slik 30
  • 26 (a)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea C04A11.3 31
  • 48 (a)
gck-4 30
  • 28 (a)
OneToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.8272 30
  • 38 (a)
OneToMany
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.14840 29
Species where no ortholog for SLK was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Tropical Clawed Frog (Silurana tropicalis)
  • Wheat (Triticum aestivum)

Evolution for SLK Gene

ENSEMBL:
Gene Tree for SLK (if available)
TreeFam:
Gene Tree for SLK (if available)
Aminode:
Evolutionary constrained regions (ECRs) for SLK: view image
Alliance of Genome Resources:
Additional Orthologs for SLK

Paralogs for SLK Gene

(7) SIMAP similar genes for SLK Gene using alignment to 2 proteins:

  • SLK_HUMAN
  • L8ECF1_HUMAN
genes like me logo Genes that share paralogs with SLK: view

Variants for SLK Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for SLK Gene

SNP ID Clinical significance and condition Chr 10 pos Variation AA Info Type
916392 Uncertain Significance: not provided 104,003,344(+) TAAAG/T
NM_014720.4(SLK):c.2169_2172del (p.Glu724fs)
FRAMESHIFT
rs1589547463 Likely Pathogenic: not provided 104,019,845(+) C/T
NM_014720.4(SLK):c.3244C>T (p.Arg1082Ter)
NONSENSE
rs187213555 Benign: not provided 104,003,514(+) C/T
NM_014720.4(SLK):c.2336C>T (p.Ser779Leu)
MISSENSE
rs190220654 An ovarian serous carcinoma sample p.Glu604Gln
rs775328978 Likely Benign: not provided 103,992,590(+) G/T
NM_014720.4(SLK):c.316-8G>T
INTRON

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for SLK Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for SLK Gene

Variant ID Type Subtype PubMed ID
dgv488e59 CNV tandem duplication 20981092
dgv967n100 CNV loss 25217958
esv3376056 CNV duplication 20981092
esv3413324 CNV insertion 20981092
esv3579098 CNV loss 25503493
esv3624424 CNV loss 21293372
nsv1118186 CNV deletion 24896259
nsv1125510 CNV tandem duplication 24896259
nsv7532 CNV insertion 18451855
nsv951008 CNV duplication 24416366

Variation tolerance for SLK Gene

Residual Variation Intolerance Score: 10.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 6.46; 77.40% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for SLK Gene

Human Gene Mutation Database (HGMD)
SLK
SNPedia medical, phenotypic, and genealogical associations of SNPs for
SLK
Leiden Open Variation Database (LOVD)
SLK

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for SLK Gene

Disorders for SLK Gene

MalaCards: The human disease database

(3) MalaCards diseases for SLK Gene - From: COP

- elite association - COSMIC cancer census association via MalaCards
Search SLK in MalaCards View complete list of genes associated with diseases

Additional Disease Information for SLK

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with SLK: view

No data available for UniProtKB/Swiss-Prot and Genatlas for SLK Gene

Publications for SLK Gene

  1. Molecular cloning and characterization of a novel human STE20-like kinase, hSLK. (PMID: 10699464) Yamada E … Yamamoto H (Biochimica et biophysica acta 2000) 3 4 22
  2. Ste20-related protein kinase LOSK (SLK) controls microtubule radial array in interphase. (PMID: 18287541) Burakov AV … Nadezhdina ES (Molecular biology of the cell 2008) 3 22
  3. A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease. (PMID: 16385451) Grupe A … Goate A (American journal of human genetics 2006) 3 40
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
  5. The DNA sequence and comparative analysis of human chromosome 10. (PMID: 15164054) Deloukas P … Rogers J (Nature 2004) 3 4

Products for SLK Gene

Sources for SLK Gene