Free for academic non-profit institutions. Other users need a Commercial license

SLK Gene(Protein Coding)

STE20 Like Kinase

GCID:
GC10P103967
GIFtS:
52
Genes Participants
UDN Logo

Aliases for SLK Gene

Aliases for SLK Gene

  • STE20 Like Kinase 2 3 5
  • STE20-Related Serine/Threonine-Protein Kinase 3 4
  • Serine/Threonine-Protein Kinase 2 3 4
  • CTCL Tumor Antigen Se20-9 3 4
  • STE20-Related Kinase 3 4
  • STE20-Like Kinase 2 4
  • EC 2.7.11.1 4 56
  • STK2 3 4
  • HSLK 3 4
  • SNF1 (Sucrose Nonfermenting, Yeast, Homolog)-Like Kinase, SNF1 Sucrose Nonfermenting Like Kinase (Yeast) 2
  • SNF1 (Sucrose Nonfermenting, Yeast, Homolog)-Like Kinase, SNF1 Sucrose Nonfermenting Like Kinase 3
  • STE20-Like Serine/Threonine-Protein Kinase 3
  • SNF1 Sucrose Nonfermenting Like Kinase 3
  • Ste20-Related Serine/Threonine Kinase 3
  • STE20-Like Kinase (Yeast) 2
  • Long Ste20-Like Kinase 3
  • BA16H23.1 3
  • EC 2.7.11 56
  • KIAA0204 4
  • Se20-9 3
  • LOSK 3

External Ids for SLK Gene

Previous GeneCards Identifiers for SLK Gene

  • GC10P104620
  • GC00U905130
  • GC10P105392
  • GC10P105716
  • GC10P099381

Summaries for SLK Gene

GeneCards Summary for SLK Gene

SLK (STE20 Like Kinase) is a Protein Coding gene. Diseases associated with SLK include Amyotrophic Lateral Sclerosis 9 and Robinow Syndrome, Autosomal Dominant 1. Among its related pathways are DNA Damage and Oocyte meiosis. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transferase activity, transferring phosphorus-containing groups. An important paralog of this gene is STK10.

UniProtKB/Swiss-Prot for SLK Gene

  • Mediates apoptosis and actin stress fiber dissolution.

Gene Wiki entry for SLK Gene

Additional gene information for SLK Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for SLK Gene

Genomics for SLK Gene

Products:

  1. Regulatory Element

GeneHancer (GH) Regulatory Elements for SLK Gene

Promoters and enhancers for SLK Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH10I103965 Promoter/Enhancer 2 EPDnew Ensembl ENCODE 550.8 +1.2 1152 5 PKNOX1 SIN3A DMAP1 YY1 POLR2B ZNF766 KLF13 REST SMARCB1 ZNF592 SLK LOC102724351 PDCD11 ENSG00000260461 TAF5 STN1 PCGF6 COL17A1 GC10P103974
GH10I103905 Enhancer 1.8 FANTOM5 Ensembl ENCODE dbSUPER 17.1 -57.6 -57564 9 HDGF SMAD1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 IRF4 YY1 CBX5 SLK STN1 ENSG00000260461 GSTO2 SH3PXD2A GSTO1 GC10M103885
GH10I103887 Enhancer 1.6 FANTOM5 Ensembl ENCODE dbSUPER 17.8 -77.7 -77701 4.2 PKNOX1 CLOCK FOXA2 NEUROD1 SIN3A ZNF2 ZNF48 ARID2 ZNF143 FOS GC10M103885 SLK SH3PXD2A MIR936 ENSG00000260461 STN1 COL17A1 SFR1 GSTO2 GSTO1
GH10I103367 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 13.1 -598.9 -598927 2.2 HDGF PKNOX1 SMAD1 ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 IRF4 TAF5 PDCD11 SFXN2 SLK ENSG00000260461 CALHM2 GC10P103388
GH10I103914 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 11.5 -49.7 -49668 6.1 HDGF PKNOX1 SMAD1 MLX ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 STN1 SLK SORCS3 GC10M103885
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around SLK on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the SLK gene promoter:

Genomic Locations for SLK Gene

Genomic Locations for SLK Gene
chr10:103,967,182-104,029,233
(GRCh38/hg38)
Size:
62,052 bases
Orientation:
Plus strand
chr10:105,726,959-105,788,991
(GRCh37/hg19)

Genomic View for SLK Gene

Genes around SLK on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
SLK Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for SLK Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for SLK Gene

Proteins for SLK Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for SLK Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H2G2-SLK_HUMAN
    Recommended name:
    STE20-like serine/threonine-protein kinase
    Protein Accession:
    Q9H2G2
    Secondary Accessions:
    • D3DRA0
    • D3DRA1
    • O00211
    • Q6P1Z4
    • Q86WU7
    • Q86WW1
    • Q92603
    • Q9NQL0
    • Q9NQL1

    Protein attributes for SLK Gene

    Size:
    1235 amino acids
    Molecular mass:
    142695 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAH47762.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 611.; Evidence={ECO:0000305}; Sequence=AAH47885.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 422.; Evidence={ECO:0000305}; Sequence=AAH64804.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 614.; Evidence={ECO:0000305}; Sequence=BAA13195.2; Type=Frameshift; Positions=1172; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for SLK Gene

    Alternative splice isoforms for SLK Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for SLK Gene

Protein Expression for SLK Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for SLK Gene

Q9H2G2:
  • FIGTPYWMAPEV
  • IIHRDLKA
  • DLNLSISSFLSK
  • GTPYWMAPEVV
  • LLVEHETQKLK
  • LLQHPFVT
  • QLQNEKC
  • WSSNFKDFL
  • EQMQRYNQR
  • ARLPKIQRS
  • LKKIIQQQKAELANIERECLNNKQQL
  • IEPPHHELNPMRVLLKIAKS
  • KQQLKDQYF
  • GTPYWMAPE
  • GELGDGAFGKVYKA
  • KLRPRKK
  • VLAAAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDA

Post-translational modifications for SLK Gene

Other Protein References for SLK Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for SLK Gene

Gene Families for SLK Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for SLK Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for SLK Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9H2G2

UniProtKB/Swiss-Prot:

SLK_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with SLK: view

Function for SLK Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for SLK Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Mediates apoptosis and actin stress fiber dissolution.

Enzyme Numbers (IUBMB) for SLK Gene

Phenotypes From GWAS Catalog for SLK Gene

Gene Ontology (GO) - Molecular Function for SLK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IDA 18239682
GO:0005515 protein binding IPI 25882817
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with SLK: view
genes like me logo Genes that share phenotypes with SLK: view

Animal Model Products

  • Taconic Biosciences Mouse Models for SLK

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for SLK Gene

Localization for SLK Gene

Subcellular locations from UniProtKB/Swiss-Prot for SLK Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for SLK gene
Compartment Confidence
extracellular 5
cytosol 4
nucleus 3
plasma membrane 2
cytoskeleton 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Plasma membrane (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for SLK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IDA,IEA 18287541
GO:0031252 cell leading edge IEA,ISS --
GO:0048471 perinuclear region of cytoplasm IDA 26094769
GO:0070062 extracellular exosome HDA,IDA 19056867
genes like me logo Genes that share ontologies with SLK: view

Pathways & Interactions for SLK Gene

genes like me logo Genes that share pathways with SLK: view

Pathways by source for SLK Gene

1 KEGG pathway for SLK Gene
1 Qiagen pathway for SLK Gene
3 Cell Signaling Technology pathways for SLK Gene

SIGNOR curated interactions for SLK Gene

Activates:
Is inactivated by:

Gene Ontology (GO) - Biological Process for SLK Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0006915 apoptotic process IEA --
GO:0007346 regulation of mitotic cell cycle IBA --
GO:0016310 phosphorylation IEA --
GO:0023014 signal transduction by protein phosphorylation IBA --
genes like me logo Genes that share ontologies with SLK: view

Drugs & Compounds for SLK Gene

Products:

  1. Drug

(5) Drugs for SLK Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
[4-({4-[(5-CYCLOPROPYL-1H-PYRAZOL-3-YL)AMINO]QUINAZOLIN-2-YL}IMINO)CYCLOHEXA-2,5-DIEN-1-YL]ACETONITRILE Experimental Pharma Target 0
5-AMINO-3-{[4-(AMINOSULFONYL)PHENYL]AMINO}-N-(2,6-DIFLUOROPHENYL)-1H-1,2,4-TRIAZOLE-1-CARBOTHIOAMIDE Experimental Pharma Target 0
ATP Investigational Nutra Agonist 0

(1) Additional Compounds for SLK Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
 Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with SLK: view

Transcripts for SLK Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for SLK Gene

(3) REFSEQ mRNAs :
(12) Additional mRNA sequences :
(330) Selected AceView cDNA sequences:
(3) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for SLK Gene

STE20-like kinase:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for SLK Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12a · 12b ^ 13 ^ 14 ^ 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19
SP1: -
SP2: - -
SP3: -

Relevant External Links for SLK Gene

GeneLoc Exon Structure for
SLK
ECgene alternative splicing isoforms for
SLK

Expression for SLK Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for SLK Gene

mRNA expression in normal human tissues for SLK Gene
mRNA expression by GTEx for SLK GenemRNA expression by BioGPS for SLK Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for SLK Gene

This gene is overexpressed in Peripheral blood mononuclear cells (12.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for SLK Gene



Protein tissue co-expression partners for SLK Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of SLK Gene:

SLK

SOURCE GeneReport for Unigene cluster for SLK Gene:

Hs.591922

mRNA Expression by UniProt/SwissProt for SLK Gene:

Q9H2G2-SLK_HUMAN
Tissue specificity: Ubiquitously expressed. Highest expression is found in heart and in skeletal muscle.

Evidence on tissue expression from TISSUES for SLK Gene

  • Liver(4.4)
  • Bone marrow(4.2)
  • Kidney(2.7)
  • Spleen(2.3)
  • Blood(2.1)
  • Muscle(2.1)
genes like me logo Genes that share expression patterns with SLK: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for SLK Gene

Orthologs for SLK Gene

This gene was present in the common ancestor of animals.

Orthologs for SLK Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia SLK 33 34
  • 99.73 (n)
dog
(Canis familiaris)
 Mammalia SLK 33 34
  • 91.44 (n)
cow
(Bos Taurus)
 Mammalia SLK 33 34
  • 90.35 (n)
platypus
(Ornithorhynchus anatinus)
 Mammalia SLK 34
  • 88 (a)
 OneToOne
mouse
(Mus musculus)
 Mammalia Slk 33 16 34
  • 84.6 (n)
rat
(Rattus norvegicus)
 Mammalia Slk 33
  • 83.79 (n)
oppossum
(Monodelphis domestica)
 Mammalia SLK 34
  • 79 (a)
 OneToOne
chicken
(Gallus gallus)
 Aves SLK 33 34
  • 73.99 (n)
lizard
(Anolis carolinensis)
 Reptilia SLK 34
  • 69 (a)
 OneToOne
zebrafish
(Danio rerio)
 Actinopterygii slka 33 34
  • 73.21 (n)
slkb 34
  • 62 (a)
 OneToMany
fruit fly
(Drosophila melanogaster)
 Insecta CG4527 35
  • 40 (a)
slik 34
  • 26 (a)
 OneToMany
worm
(Caenorhabditis elegans)
 Secernentea C04A11.3 35
  • 48 (a)
gck-4 34
  • 28 (a)
 OneToMany
sea squirt
(Ciona savignyi)
 Ascidiacea CSA.8272 34
  • 38 (a)
 OneToMany
sea squirt
(Ciona intestinalis)
 Ascidiacea Cin.14840 33
Species where no ortholog for SLK was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for SLK Gene

ENSEMBL:
Gene Tree for SLK (if available)
TreeFam:
Gene Tree for SLK (if available)

Paralogs for SLK Gene

Paralogs for SLK Gene

(7) SIMAP similar genes for SLK Gene using alignment to 2 proteins:

genes like me logo Genes that share paralogs with SLK: view

Variants for SLK Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations from dbSNP and Humsavar for SLK Gene

SNP ID Clin Chr 10 pos Variation AA Info Type
rs190220654 An ovarian serous carcinoma sample 104,002,988(+) G/C coding_sequence_variant, intron_variant, missense_variant
VAR_041080 A lung adenocarcinoma sample p.Gln405Lys
rs1000023067 -- 103,969,056(+) C/G intron_variant
rs1000028672 -- 104,015,490(+) C/T intron_variant
rs1000036997 -- 104,015,860(+) G/A intron_variant

Structural Variations from Database of Genomic Variants (DGV) for SLK Gene

Variant ID Type Subtype PubMed ID
dgv488e59 CNV tandem duplication 20981092
dgv967n100 CNV loss 25217958
esv3376056 CNV duplication 20981092
esv3413324 CNV insertion 20981092
esv3579098 CNV loss 25503493
esv3624424 CNV loss 21293372
nsv1118186 CNV deletion 24896259
nsv1125510 CNV tandem duplication 24896259
nsv7532 CNV insertion 18451855
nsv951008 CNV duplication 24416366

Variation tolerance for SLK Gene

Residual Variation Intolerance Score: 10.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 6.46; 77.40% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for SLK Gene

Human Gene Mutation Database (HGMD)
SLK
SNPedia medical, phenotypic, and genealogical associations of SNPs for
SLK

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for SLK Gene

Disorders for SLK Gene

MalaCards: The human disease database

(2) MalaCards diseases for SLK Gene - From: HGMD and DISEASES

- elite association - COSMIC cancer census association via MalaCards
Search SLK in MalaCards View complete list of genes associated with diseases

Additional Disease Information for SLK

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with SLK: view

No data available for UniProtKB/Swiss-Prot and Genatlas for SLK Gene

Publications for SLK Gene

  1. Molecular cloning and characterization of a novel human STE20-like kinase, hSLK. (PMID: 10699464) Yamada E … Yamamoto H (Biochimica et biophysica acta 2000) 3 4 22 58
  2. Ste20-related protein kinase LOSK (SLK) controls microtubule radial array in interphase. (PMID: 18287541) Burakov AV … Nadezhdina ES (Molecular biology of the cell 2008) 3 22 58
  3. A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease. (PMID: 16385451) Grupe A … Goate A (American journal of human genetics 2006) 3 44 58
  4. The DNA sequence and comparative analysis of human chromosome 10. (PMID: 15164054) Deloukas P … Rogers J (Nature 2004) 3 4 58
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58

Products for SLK Gene

Sources for SLK Gene

Content
Loading form....