This gene encodes an integral membrane protein, which is localized to the endoplasmic reticulum, and functions as a phosphoinositide phosphatase that hydrolyzes phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, and phosphatidylinositol 3,5-bisphosphate. Deletion of this gene in mouse results in preimplantation lethality. Other studies suggest that this gene is... See more...

Aliases for SACM1L Gene

Aliases for SACM1L Gene

  • SAC1 Like Phosphatidylinositide Phosphatase 2 3 5
  • SAC1 2 3 4
  • Phosphatidylinositol-4-Phosphate Phosphatase 3 4
  • Suppressor Of Actin Mutations 1-Like Protein 3 4
  • Phosphatidylinositol-3-Phosphatase SAC1 3 4
  • KIAA0851 2 4
  • SAC1 Suppressor Of Actin Mutations 1 Like (Yeast) 2
  • SAC1 Suppressor Of Actin Mutations 1 Like 3
  • Phosphatidylinositide Phosphatase SAC1 3
  • Suppressor Of Actin 1 3
  • EC 3.1.3.36 50
  • EC 3.1.3.77 50
  • EC 3.1.3.64 4
  • EC 3.1.3 50
  • SACM1L 5

External Ids for SACM1L Gene

Previous GeneCards Identifiers for SACM1L Gene

  • GC03P044971
  • GC03P045550
  • GC03P045691
  • GC03P045706
  • GC03P045730

Summaries for SACM1L Gene

Entrez Gene Summary for SACM1L Gene

  • This gene encodes an integral membrane protein, which is localized to the endoplasmic reticulum, and functions as a phosphoinositide phosphatase that hydrolyzes phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, and phosphatidylinositol 3,5-bisphosphate. Deletion of this gene in mouse results in preimplantation lethality. Other studies suggest that this gene is also involved in the organization of golgi membranes and mitotic spindles. Alternatively spliced transcript variants have been found for this gene. A C-terminally extended isoform is also predicted to be produced by the use of an alternative in-frame, downstream translation termination codon via a stop codon readthrough mechanism.[provided by RefSeq, Dec 2017]

GeneCards Summary for SACM1L Gene

SACM1L (SAC1 Like Phosphatidylinositide Phosphatase) is a Protein Coding gene. Diseases associated with SACM1L include Parkinson Disease 20, Early-Onset and Spherocytosis, Type 1. Among its related pathways are Glycerophospholipid biosynthesis and superpathway of inositol phosphate compounds. Gene Ontology (GO) annotations related to this gene include phosphatase activity and phosphoric ester hydrolase activity. An important paralog of this gene is INPP5F.

UniProtKB/Swiss-Prot Summary for SACM1L Gene

  • Phosphoinositide phosphatase which catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) (PubMed:24209621, PubMed:27044890, PubMed:29461204, PubMed:30659099). Can also catalyze the hydrolysis of phosphatidylinositol 3-phosphate (PtdIns(3)P) and has low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2) (By similarity). Shows a very robust PtdIns(4)P phosphatase activity when it binds PtdIns(4)P in a 'cis' configuration in the cellular environment, with much less activity seen when it binds PtdIns(4)P in 'trans' configuration (PubMed:29461204, PubMed:24209621, PubMed:30659099). PtdIns(4)P phosphatase activity (when it binds PtdIns(4)P in 'trans' configuration) is enhanced in the presence of PLEKHA3 (PubMed:30659099).

Gene Wiki entry for SACM1L Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for SACM1L Gene

Genomics for SACM1L Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for SACM1L Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around SACM1L on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for SACM1L

Top Transcription factor binding sites by QIAGEN in the SACM1L gene promoter:
  • AML1a
  • AP-1
  • c-Myc
  • CBF(2)
  • CBF-A
  • CBF-C
  • CP1A
  • CP1C
  • Max
  • NF-Y

Genomic Locations for SACM1L Gene

Latest Assembly
chr3:45,689,056-45,745,409
(GRCh38/hg38)
Size:
56,354 bases
Orientation:
Plus strand

Previous Assembly
chr3:45,730,888-45,786,901
(GRCh37/hg19 by Entrez Gene)
Size:
56,014 bases
Orientation:
Plus strand

chr3:45,730,548-45,786,916
(GRCh37/hg19 by Ensembl)
Size:
56,369 bases
Orientation:
Plus strand

Genomic View for SACM1L Gene

Genes around SACM1L on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
SACM1L Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for SACM1L Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for SACM1L Gene

Proteins for SACM1L Gene

  • Protein details for SACM1L Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9NTJ5-SAC1_HUMAN
    Recommended name:
    Phosphatidylinositol-3-phosphatase SAC1
    Protein Accession:
    Q9NTJ5
    Secondary Accessions:
    • A8K527
    • B4DK71
    • O94935
    • Q7LA14
    • Q7LA22
    • Q96AX7
    • Q9NQ46
    • Q9NQ57

    Protein attributes for SACM1L Gene

    Size:
    587 amino acids
    Molecular mass:
    66967 Da
    Quaternary structure:
    • Interacts with TMEM39A (PubMed:31806350). Interacts with SEC23A and SEC24A; this interaction is reduced in the absence of TMEM39A (PubMed:31806350). Interacts with PLEKHA3 and VAPA and/or VAPB to form a ternary complex (PubMed:30659099).
    SequenceCaution:
    • Sequence=BAA74874.2; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for SACM1L Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for SACM1L Gene

Selected DME Specific Peptides for SACM1L Gene

Q9NTJ5:
  • QDNKTFL
  • QRFVWNG
  • FVQTRGS
  • WSQRPNLKYKP
  • QRLSNTSP
  • DCLDRTN
  • RGSIPVFW
  • GTIHLVAGNYL
  • NCMDCLDRTNV
  • QSLLARRSLQ
  • VGQKLEE
  • IMVVAFSMCIICLLMAGDTWTETLAYVLFWG
  • QTRGSIP
  • LKLHITPEKFYVEACD
  • FQEMSLLERADQRF
  • YAGTGAL
  • IDRVSTE
  • VETEQIV
  • IYGKQVI
  • YDLTHTLQRL
  • FEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRT
  • LHLTDIQ
  • DGFQRHFDSQ
  • SYKKTMLHLTD
  • QLQRLGVLHVGQ
  • RQDSIDLFLG

Post-translational modifications for SACM1L Gene

  • Ubiquitination at Lys250 and Lys483
  • Modification sites at PhosphoSitePlus

Antibodies for research

  • Abcam antibodies for SACM1L

Domains & Families for SACM1L Gene

Gene Families for SACM1L Gene

HGNC:
Human Protein Atlas (HPA):
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for SACM1L Gene

InterPro:
Blocks:
  • Synaptojanin, N-terminal

Suggested Antigen Peptide Sequences for SACM1L Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ55660, highly similar to Homo sapiens SAC1 suppressor of actin mutations 1-like (SACM1L), mRNA (B4DK71_HUMAN)
  • Suppressor of actin mutations 1-like protein (SAC1_HUMAN)
genes like me logo Genes that share domains with SACM1L: view

No data available for Graphical View of Domain Structure and UniProtKB/Swiss-Prot for SACM1L Gene

Function for SACM1L Gene

Molecular function for SACM1L Gene

UniProtKB/Swiss-Prot Function:
Phosphoinositide phosphatase which catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) (PubMed:24209621, PubMed:27044890, PubMed:29461204, PubMed:30659099). Can also catalyze the hydrolysis of phosphatidylinositol 3-phosphate (PtdIns(3)P) and has low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2) (By similarity). Shows a very robust PtdIns(4)P phosphatase activity when it binds PtdIns(4)P in a 'cis' configuration in the cellular environment, with much less activity seen when it binds PtdIns(4)P in 'trans' configuration (PubMed:29461204, PubMed:24209621, PubMed:30659099). PtdIns(4)P phosphatase activity (when it binds PtdIns(4)P in 'trans' configuration) is enhanced in the presence of PLEKHA3 (PubMed:30659099).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate; Xref=Rhea:RHEA:12316, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:57880, ChEBI:CHEBI:58088; EC=3.1.3.64; Evidence={ECO:0000250|UniProtKB:P32368};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate; Xref=Rhea:RHEA:55652, ChEBI:CHEBI:15377, ChEBI:CHEBI:43474, ChEBI:CHEBI:57880, ChEBI:CHEBI:58178; Evidence={ECO:0000269|PubMed:24209621, ECO:0000269|PubMed:27044890, ECO:0000269|PubMed:29461204, ECO:0000269|PubMed:30659099};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by bis-peroxovanadates and hydrogen peroxide.

Enzyme Numbers (IUBMB) for SACM1L Gene

Phenotypes From GWAS Catalog for SACM1L Gene

Gene Ontology (GO) - Molecular Function for SACM1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004438 phosphatidylinositol-3-phosphatase activity IEA,TAS --
GO:0005515 protein binding IPI 14527956
GO:0016787 hydrolase activity IEA --
GO:0016791 phosphatase activity IEA,ISS --
GO:0034593 phosphatidylinositol bisphosphate phosphatase activity IEA --
genes like me logo Genes that share ontologies with SACM1L: view
genes like me logo Genes that share phenotypes with SACM1L: view

Animal Models for SACM1L Gene

MGI Knock Outs for SACM1L:
  • Sacm1l Sacm1l<tm1b(KOMP)Wtsi>

Animal Models for research

  • Taconic Biosciences Mouse Models for SACM1L

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for SACM1L

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for SACM1L Gene

Localization for SACM1L Gene

Subcellular locations from UniProtKB/Swiss-Prot for SACM1L Gene

Endoplasmic reticulum membrane. Multi-pass membrane protein. Golgi apparatus membrane. Note=Trafficking between the ER and Golgi is regulated by nutrient status and by TMEM39A (PubMed:31806350). Localizes to endoplasmic reticulum-plasma membrane contact sites (EPCS) in the presence of phosphatidylinositol-4,5-bisphosphate (PubMed:27044890). {ECO:0000269 PubMed:27044890, ECO:0000269 PubMed:31806350}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for SACM1L gene
Compartment Confidence
golgi apparatus 5
endoplasmic reticulum 4
plasma membrane 3
cytosol 3
cytoskeleton 2
mitochondrion 2
nucleus 2
endosome 2
lysosome 2
extracellular 1
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Golgi apparatus (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for SACM1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005783 endoplasmic reticulum IBA 21873635
GO:0005789 endoplasmic reticulum membrane IEA,TAS --
GO:0005794 Golgi apparatus IEA,IDA 31806350
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with SACM1L: view

Pathways & Interactions for SACM1L Gene

genes like me logo Genes that share pathways with SACM1L: view

Gene Ontology (GO) - Biological Process for SACM1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006661 phosphatidylinositol biosynthetic process TAS --
GO:0046856 phosphatidylinositol dephosphorylation IEA,IDA 24209621
genes like me logo Genes that share ontologies with SACM1L: view

No data available for SIGNOR curated interactions for SACM1L Gene

Drugs & Compounds for SACM1L Gene

(3) Drugs for SACM1L Gene - From: PharmGKB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Bupropion Approved Pharma 414
genes like me logo Genes that share compounds with SACM1L: view

Transcripts for SACM1L Gene

mRNA/cDNA for SACM1L Gene

4 REFSEQ mRNAs :
12 NCBI additional mRNA sequence :
17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for SACM1L

Alternative Splicing Database (ASD) splice patterns (SP) for SACM1L Gene

No ASD Table

Relevant External Links for SACM1L Gene

GeneLoc Exon Structure for
SACM1L

Expression for SACM1L Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for SACM1L Gene

Protein differential expression in normal tissues from HIPED for SACM1L Gene

This gene is overexpressed in Peripheral blood mononuclear cells (11.9), Platelet (8.1), and Adrenal (6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for SACM1L Gene



Protein tissue co-expression partners for SACM1L Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for SACM1L

SOURCE GeneReport for Unigene cluster for SACM1L Gene:

Hs.156509

mRNA Expression by UniProt/SwissProt for SACM1L Gene:

Q9NTJ5-SAC1_HUMAN
Tissue specificity: Detected in heart, brain, lung, liver, kidney, pancreas and testis.

Evidence on tissue expression from TISSUES for SACM1L Gene

  • Nervous system(4.9)
  • Liver(4.5)
  • Kidney(2.5)
  • Skin(2.5)
  • Blood(2.5)
  • Heart(2.3)
  • Eye(2.3)
  • Spleen(2.2)
  • Thyroid gland(2.1)
  • Lung(2.1)
  • Intestine(2)
genes like me logo Genes that share expression patterns with SACM1L: view

Primer products for research

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for SACM1L Gene

Orthologs for SACM1L Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for SACM1L Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia SACM1L 29 30
  • 97.79 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia SACM1L 29 30
  • 92.28 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia SACM1L 29 30
  • 91.65 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Sacm1l 29
  • 91.43 (n)
Mouse
(Mus musculus)
Mammalia Sacm1l 29 16 30
  • 91.14 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia SACM1L 30
  • 88 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia SACM1L 30
  • 87 (a)
OneToOne
Chicken
(Gallus gallus)
Aves SACM1L 29 30
  • 79.94 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia SACM1L 30
  • 78 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia Str.13854 29
Zebrafish
(Danio rerio)
Actinopterygii sacm1la 30
  • 78 (a)
OneToMany
sacm1lb 29 30
  • 70.21 (n)
OneToMany
Fruit Fly
(Drosophila melanogaster)
Insecta Sac1 29 30 31
  • 51.64 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP000891 29
  • 50.03 (n)
Worm
(Caenorhabditis elegans)
Secernentea sac-1 29 30
  • 54.5 (n)
OneToOne
F30A10.6 31
  • 45 (a)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SAC1 29 30
  • 47.52 (n)
OneToMany
K. Lactis Yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0B14388g 29
  • 46.71 (n)
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_AER447C 29
  • 46.35 (n)
Thale Cress
(Arabidopsis thaliana)
eudicotyledons RHD4 29
  • 46.9 (n)
Rice
(Oryza sativa)
Liliopsida Os11g0309000 29
  • 46.53 (n)
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.2353 30
  • 49 (a)
OneToOne
Fission Yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes SPBC19F5.03 29
  • 48.34 (n)
Bread mold
(Neurospora crassa)
Ascomycetes NCU00896 29
  • 46.34 (n)
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.7050 29
Species where no ortholog for SACM1L was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for SACM1L Gene

ENSEMBL:
Gene Tree for SACM1L (if available)
TreeFam:
Gene Tree for SACM1L (if available)
Aminode:
Evolutionary constrained regions (ECRs) for SACM1L: view image
Alliance of Genome Resources:
Additional Orthologs for SACM1L

Paralogs for SACM1L Gene

(1) SIMAP similar genes for SACM1L Gene using alignment to 8 proteins:

  • SAC1_HUMAN
  • B4DK71_HUMAN
  • C9J3E3_HUMAN
  • C9JV50_HUMAN
  • E9PGZ4_HUMAN
  • F8WCQ2_HUMAN
  • F8WD07_HUMAN
  • F8WDN7_HUMAN
genes like me logo Genes that share paralogs with SACM1L: view

Variants for SACM1L Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for SACM1L Gene

SNP ID Clinical significance and condition Chr 03 pos Variation AA Info Type
rs1468542 -- p.Tyr434Phe

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for SACM1L Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for SACM1L Gene

Variant ID Type Subtype PubMed ID
esv1482139 CNV deletion 17803354
esv1993720 CNV deletion 18987734
esv2554417 CNV deletion 19546169
esv2671340 CNV deletion 23128226
esv2725224 CNV deletion 23290073
esv33645 CNV loss 17666407
esv34130 CNV loss 18971310
esv3561819 CNV deletion 23714750
esv3596053 CNV loss 21293372
nsv1072686 CNV deletion 25765185
nsv1123642 CNV deletion 24896259
nsv819738 CNV gain 19587683
nsv955587 CNV deletion 24416366

Variation tolerance for SACM1L Gene

Residual Variation Intolerance Score: 25.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.94; 19.49% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for SACM1L Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
SACM1L
Leiden Open Variation Database (LOVD)
SACM1L

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for SACM1L Gene

Disorders for SACM1L Gene

MalaCards: The human disease database

(16) MalaCards diseases for SACM1L Gene - From: COP

- elite association - COSMIC cancer census association via MalaCards

Additional Disease Information for SACM1L

genes like me logo Genes that share disorders with SACM1L: view

No data available for UniProtKB/Swiss-Prot and Genatlas for SACM1L Gene

Publications for SACM1L Gene

  1. The LZTFL1 gene is a part of a transcriptional map covering 250 kb within the common eliminated region 1 (C3CER1) in 3p21.3. (PMID: 11352561) Kiss H … Dumanski JP (Genomics 2001) 2 3 4 22
  2. Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10048485) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1998) 2 3 4
  3. The ER-Localized Transmembrane Protein TMEM39A/SUSR2 Regulates Autophagy by Controlling the Trafficking of the PtdIns(4)P Phosphatase SAC1. (PMID: 31806350) Miao G … Zhang H (Molecular cell 2020) 3 4
  4. The activity of Sac1 across ER-TGN contact sites requires the four-phosphate-adaptor-protein-1. (PMID: 30659099) Venditti R … De Matteis MA (The Journal of cell biology 2019) 3 4
  5. SAC1 degrades its lipid substrate PtdIns4P in the endoplasmic reticulum to maintain a steep chemical gradient with donor membranes. (PMID: 29461204) Zewe JP … Hammond GR (eLife 2018) 3 4

Products for SACM1L Gene

Sources for SACM1L Gene