This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternativ... See more...

Aliases for RPS6KB1 Gene

Aliases for RPS6KB1 Gene

  • Ribosomal Protein S6 Kinase B1 2 3 5
  • Serine/Threonine-Protein Kinase 14A 3 4
  • Ribosomal Protein S6 Kinase Beta-1 3 4
  • Ribosomal Protein S6 Kinase I 3 4
  • EC 2.7.11.1 4 54
  • S6K-Beta-1 3 4
  • P70 S6KA 3 4
  • STK14A 3 4
  • S6K1 3 4
  • Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 3
  • Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1 2
  • 70 KDa Ribosomal Protein S6 Kinase 1 4
  • Serine/Threonine Kinase 14 Alpha 3
  • P70 Ribosomal S6 Kinase Alpha 4
  • P70 S6 Kinase, Alpha 3
  • P70 S6 Kinase Alpha 4
  • P70(S6K)-Alpha 3
  • P70 S6K-Alpha 4
  • P70-Alpha 3
  • P70-S6K 1 4
  • EC 2.7.11 54
  • P70-S6K 3
  • P70S6K1 4
  • PS6K 3
  • S6K 3

External Ids for RPS6KB1 Gene

Previous HGNC Symbols for RPS6KB1 Gene

  • STK14A

Previous GeneCards Identifiers for RPS6KB1 Gene

  • GC17M060023
  • GC17P060420
  • GC17P058312
  • GC17P058444
  • GC17P055325
  • GC17P057970
  • GC17P053343

Summaries for RPS6KB1 Gene

Entrez Gene Summary for RPS6KB1 Gene

  • This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17. [provided by RefSeq, Jan 2013]

GeneCards Summary for RPS6KB1 Gene

RPS6KB1 (Ribosomal Protein S6 Kinase B1) is a Protein Coding gene. Diseases associated with RPS6KB1 include Tuberous Sclerosis and Glioblastoma Multiforme. Among its related pathways are Development IGF-1 receptor signaling and Prolactin Signaling Pathway. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is RPS6KB2.

UniProtKB/Swiss-Prot Summary for RPS6KB1 Gene

  • Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression. Regulates protein synthesis through phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD. Under conditions of nutrient depletion, the inactive form associates with the EIF3 translation initiation complex. Upon mitogenic stimulation, phosphorylation by the mammalian target of rapamycin complex 1 (mTORC1) leads to dissociation from the EIF3 complex and activation. The active form then phosphorylates and activates several substrates in the pre-initiation complex, including the EIF2B complex and the cap-binding complex component EIF4B. Also controls translation initiation by phosphorylating a negative regulator of EIF4A, PDCD4, targeting it for ubiquitination and subsequent proteolysis. Promotes initiation of the pioneer round of protein synthesis by phosphorylating POLDIP3/SKAR. In response to IGF1, activates translation elongation by phosphorylating EEF2 kinase (EEF2K), which leads to its inhibition and thus activation of EEF2. Also plays a role in feedback regulation of mTORC2 by mTORC1 by phosphorylating RICTOR, resulting in the inhibition of mTORC2 and AKT1 signaling. Mediates cell survival by phosphorylating the pro-apoptotic protein BAD and suppressing its pro-apoptotic function. Phosphorylates mitochondrial URI1 leading to dissociation of a URI1-PPP1CC complex. The free mitochondrial PPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which is proposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function. Mediates TNF-alpha-induced insulin resistance by phosphorylating IRS1 at multiple serine residues, resulting in accelerated degradation of IRS1. In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B. May be involved in cytoskeletal rearrangement through binding to neurabin. Phosphorylates and activates the pyrimidine biosynthesis enzyme CAD, downstream of MTOR (PubMed:11500364, PubMed:12801526, PubMed:14673156, PubMed:15071500, PubMed:15341740, PubMed:16286006, PubMed:17052453, PubMed:17053147, PubMed:17936702, PubMed:18952604, PubMed:19085255, PubMed:19720745, PubMed:19935711, PubMed:19995915, PubMed:23429703). Following activation by mTORC1, phosphorylates EPRS and thereby plays a key role in fatty acid uptake by adipocytes and also most probably in interferon-gamma-induced translation inhibition (PubMed:28178239).

Tocris Summary for RPS6KB1 Gene

  • Ribosomal S6 protein kinases (RSKs) are a family of protein serine/threonine kinases that regulate diverse cellular processes such as cellular growth, motility, survival and proliferation. The RSK family can be divided into two subfamilies, namely p90 RSK and p70 S6K.

Gene Wiki entry for RPS6KB1 Gene

Additional gene information for RPS6KB1 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for RPS6KB1 Gene

Genomics for RPS6KB1 Gene

GeneHancer (GH) Regulatory Elements for RPS6KB1 Gene

Promoters and enhancers for RPS6KB1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around RPS6KB1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the RPS6KB1 gene promoter:
  • CREB
  • deltaCREB
  • E2F
  • E2F-1
  • NF-1
  • NF-1/L
  • POU3F2
  • POU3F2 (N-Oct-5a)
  • POU3F2 (N-Oct-5b)
  • YY1

Genomic Locations for RPS6KB1 Gene

Genomic Locations for RPS6KB1 Gene
chr17:59,893,046-59,950,574
(GRCh38/hg38)
Size:
57,529 bases
Orientation:
Plus strand
chr17:57,970,443-58,027,925
(GRCh37/hg19)
Size:
57,483 bases
Orientation:
Plus strand

Genomic View for RPS6KB1 Gene

Genes around RPS6KB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RPS6KB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RPS6KB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RPS6KB1 Gene

Proteins for RPS6KB1 Gene

  • Protein details for RPS6KB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P23443-KS6B1_HUMAN
    Recommended name:
    Ribosomal protein S6 kinase beta-1
    Protein Accession:
    P23443
    Secondary Accessions:
    • B2R779
    • B4DLT4
    • B4DTG1
    • E7ESB8
    • F6UYM1
    • Q7Z721

    Protein attributes for RPS6KB1 Gene

    Size:
    525 amino acids
    Molecular mass:
    59140 Da
    Quaternary structure:
    • Interacts with PPP1R9A/neurabin-1 (By similarity). Interacts with RPTOR (PubMed:12150926). Interacts with IRS1 (PubMed:18952604). Interacts with EIF3B and EIF3C (PubMed:16286006). Interacts with TRAF4 (PubMed:12801526). Interacts with POLDIP3 (PubMed:15341740). Interacts (via N-terminus) with IER5 (PubMed:26496226).

    Three dimensional structures from OCA and Proteopedia for RPS6KB1 Gene

    Alternative splice isoforms for RPS6KB1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RPS6KB1 Gene

Selected DME Specific Peptides for RPS6KB1 Gene

P23443:
  • YMAPEIL
  • GIIYRDLK
  • REAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHG
  • SEEDVSQ
  • LQSEEDVSQFD
  • KLTDFGLCKESIH
  • YAFQTGGKLYLILE
  • FLGFTYVAPSVL
  • FCGTIEYMAP
  • GHNRAVDWWSLGALMYDMLTG
  • KGGYGKVF
  • SGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
  • EDTACFYLAEI
  • LGKGGYG
  • KLTDFGL
  • AKDTAHT
  • RDLKPEN
  • FTRQTPVDSPDD
  • DFGLCKE

Post-translational modifications for RPS6KB1 Gene

  • Phosphorylation at Thr-412 is regulated by mTORC1. The phosphorylation at this site is maintained by an agonist-dependent autophosphorylation mechanism (By similarity). Activated by phosphorylation at Thr-252 by PDPK1. Dephosphorylation by PPP1CC at Thr-412 in mitochondrion.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Abcam antibodies for RPS6KB1

Domains & Families for RPS6KB1 Gene

Gene Families for RPS6KB1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for RPS6KB1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ53847, highly similar to Ribosomal protein S6 kinase beta-1 (EC 2.7.11.1) (B4DLT4_HUMAN)
  • p70 ribosomal S6 kinase alpha (KS6B1_HUMAN)
  • RPS6KB1 protein (Q4G0X7_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P23443

UniProtKB/Swiss-Prot:

KS6B1_HUMAN :
  • The autoinhibitory domain is believed to block phosphorylation within the AGC-kinase C-terminal domain and the activation loop.
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
Domain:
  • The autoinhibitory domain is believed to block phosphorylation within the AGC-kinase C-terminal domain and the activation loop.
  • The TOS (TOR signaling) motif is essential for activation by mTORC1.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
genes like me logo Genes that share domains with RPS6KB1: view

Function for RPS6KB1 Gene

Molecular function for RPS6KB1 Gene

UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression. Regulates protein synthesis through phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD. Under conditions of nutrient depletion, the inactive form associates with the EIF3 translation initiation complex. Upon mitogenic stimulation, phosphorylation by the mammalian target of rapamycin complex 1 (mTORC1) leads to dissociation from the EIF3 complex and activation. The active form then phosphorylates and activates several substrates in the pre-initiation complex, including the EIF2B complex and the cap-binding complex component EIF4B. Also controls translation initiation by phosphorylating a negative regulator of EIF4A, PDCD4, targeting it for ubiquitination and subsequent proteolysis. Promotes initiation of the pioneer round of protein synthesis by phosphorylating POLDIP3/SKAR. In response to IGF1, activates translation elongation by phosphorylating EEF2 kinase (EEF2K), which leads to its inhibition and thus activation of EEF2. Also plays a role in feedback regulation of mTORC2 by mTORC1 by phosphorylating RICTOR, resulting in the inhibition of mTORC2 and AKT1 signaling. Mediates cell survival by phosphorylating the pro-apoptotic protein BAD and suppressing its pro-apoptotic function. Phosphorylates mitochondrial URI1 leading to dissociation of a URI1-PPP1CC complex. The free mitochondrial PPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which is proposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function. Mediates TNF-alpha-induced insulin resistance by phosphorylating IRS1 at multiple serine residues, resulting in accelerated degradation of IRS1. In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B. May be involved in cytoskeletal rearrangement through binding to neurabin. Phosphorylates and activates the pyrimidine biosynthesis enzyme CAD, downstream of MTOR (PubMed:11500364, PubMed:12801526, PubMed:14673156, PubMed:15071500, PubMed:15341740, PubMed:16286006, PubMed:17052453, PubMed:17053147, PubMed:17936702, PubMed:18952604, PubMed:19085255, PubMed:19720745, PubMed:19935711, PubMed:19995915, PubMed:23429703). Following activation by mTORC1, phosphorylates EPRS and thereby plays a key role in fatty acid uptake by adipocytes and also most probably in interferon-gamma-induced translation inhibition (PubMed:28178239).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269 PubMed:17936702, ECO:0000269 PubMed:18952604, ECO:0000269 PubMed:19085255, ECO:0000269 PubMed:28178239};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269 PubMed:17936702, ECO:0000269 PubMed:18952604, ECO:0000269 PubMed:19085255, ECO:0000269 PubMed:28178239};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activation requires multiple phosphorylation events on serine/threonine residues. Activation appears to be first mediated by phosphorylation of multiple sites in the autoinhibitory domain, which facilitates phosphorylation at Thr-412, disrupting the autoinhibitory mechanism and allowing phosphorylation of Thr-252 by PDPK1. The active conformation of the kinase is believed to be stabilized by a mechanism involving three conserved phosphorylation sites located in the kinase domain activation loop (Thr-252) and in the AGC-kinase C-terminal domain (Ser-394 in the middle of the tail/linker region and Thr-412 within a hydrophobic motif at its end). Activated by mTORC1; isoform Alpha I and isoform Alpha II are sensitive to rapamycin, which inhibits activating phosphorylation at Thr-412. Activated by PDPK1.
GENATLAS Biochemistry:
ribosomal protein S6 kinase,70kDa,polypeptide 1,widely expressed,not involved in vivo in the phosphorylation of RPS6,mediating protein synthesis initiation and elongation induced by hormones or growth factors,maybe playing an essential regulatory role in protein synthesis during cell proliferation

Enzyme Numbers (IUBMB) for RPS6KB1 Gene

Phenotypes From GWAS Catalog for RPS6KB1 Gene

Gene Ontology (GO) - Molecular Function for RPS6KB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity TAS,IDA 17936702
GO:0004674 protein serine/threonine kinase activity IBA 21873635
GO:0004711 ribosomal protein S6 kinase activity IBA 21873635
GO:0004712 protein serine/threonine/tyrosine kinase activity IDA 22797923
genes like me logo Genes that share ontologies with RPS6KB1: view
genes like me logo Genes that share phenotypes with RPS6KB1: view

Animal Models for RPS6KB1 Gene

MGI Knock Outs for RPS6KB1:

Animal Model Products

  • Taconic Biosciences Mouse Models for RPS6KB1

CRISPR Products

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for RPS6KB1 Gene

Localization for RPS6KB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RPS6KB1 Gene

Cell junction, synapse, synaptosome. Mitochondrion outer membrane. Mitochondrion. Note=Colocalizes with URI1 at mitochondrion.
Isoform Alpha I: Nucleus. Cytoplasm.
Isoform Alpha II: Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RPS6KB1 gene
Compartment Confidence
mitochondrion 5
nucleus 5
cytosol 5
plasma membrane 2
extracellular 2
cytoskeleton 2
lysosome 2
golgi apparatus 2
endoplasmic reticulum 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for RPS6KB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IBA 21873635
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IBA 21873635
GO:0005739 mitochondrion IDA,IEA 17936702
GO:0005741 mitochondrial outer membrane IEA --
genes like me logo Genes that share ontologies with RPS6KB1: view

Pathways & Interactions for RPS6KB1 Gene

genes like me logo Genes that share pathways with RPS6KB1: view

Pathways by source for RPS6KB1 Gene

25 Qiagen pathways for RPS6KB1 Gene
  • 14-3-3 Induced Intracellular Signaling
  • Akt Signaling
  • AMPK Enzyme Complex Pathway
  • BAD Phosphorylation
  • cAMP Pathway
1 Cell Signaling Technology pathway for RPS6KB1 Gene
1 GeneTex pathway for RPS6KB1 Gene

SIGNOR curated interactions for RPS6KB1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for RPS6KB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000082 G1/S transition of mitotic cell cycle IMP 14673156
GO:0006417 regulation of translation IEA --
GO:0006468 protein phosphorylation IBA 21873635
GO:0006915 apoptotic process IEA --
GO:0007049 cell cycle IEA --
genes like me logo Genes that share ontologies with RPS6KB1: view

Drugs & Compounds for RPS6KB1 Gene

(56) Drugs for RPS6KB1 Gene - From: ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0
XL418 Investigational Pharma inhibitor 0
PF 4708671 Pharma P70 S6K1 isoform inhibitor,cell-permeable, S6K1 inhibitor 0
A-443654 Pharma Akt inhibitor,potent and selective 0
AT7867 Pharma Akt1/2/3 and p70S6K/PKA inhibitor 0

(32) Additional Compounds for RPS6KB1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
RMM 46
1307896-46-3

(4) Tocris Compounds for RPS6KB1 Gene

Compound Action Cas Number
BRD 7389 Ribosomal S6 kinase inhibitor 376382-11-5
PF 4708671 S6K1 inhibitor 1255517-76-0
RMM 46 MSK/RSK family kinase inhibitor 1307896-46-3
SL 0101-1 Selective ribosomal S6 kinase (RSK) inhibitor 77307-50-7

(7) ApexBio Compounds for RPS6KB1 Gene

Compound Action Cas Number
A-443654 Akt inhibitor,potent and selective 552325-16-3
AT7867 Akt1/2/3 and p70S6K/PKA inhibitor 857531-00-1
BI-D1870 P90 RSK inhibitor,ATP-competitive and cell-permeable 501437-28-1
FMK RSK inhibitor 821794-92-7
H 89 2HCl Potent PKA inhibitor 130964-39-5
LY2584702 p70 S6 kinase inhibitor 1082949-67-4
PF-4708671 P70 S6K1 isoform inhibitor,cell-permeable 1255517-76-0
genes like me logo Genes that share compounds with RPS6KB1: view

Drug Products

Transcripts for RPS6KB1 Gene

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for RPS6KB1 Gene

No ASD Table

Relevant External Links for RPS6KB1 Gene

GeneLoc Exon Structure for
RPS6KB1
ECgene alternative splicing isoforms for
RPS6KB1

Expression for RPS6KB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for RPS6KB1 Gene

Protein differential expression in normal tissues from HIPED for RPS6KB1 Gene

This gene is overexpressed in CD8 Tcells (13.8), Fetal testis (8.2), Placenta (7.4), NK cells (7.3), and Ovary (6.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for RPS6KB1 Gene



Protein tissue co-expression partners for RPS6KB1 Gene

NURSA nuclear receptor signaling pathways regulating expression of RPS6KB1 Gene:

RPS6KB1

SOURCE GeneReport for Unigene cluster for RPS6KB1 Gene:

Hs.463642

mRNA Expression by UniProt/SwissProt for RPS6KB1 Gene:

P23443-KS6B1_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for RPS6KB1 Gene

  • Eye(4.3)
  • Nervous system(3.8)
  • Muscle(3.4)
  • Heart(2.7)
  • Liver(2.7)
  • Blood(2.4)
  • Intestine(2.4)
  • Lung(2.4)
  • Kidney(2.3)
  • Pancreas(2.2)
  • Skin(2)
genes like me logo Genes that share expression patterns with RPS6KB1: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for RPS6KB1 Gene

Orthologs for RPS6KB1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for RPS6KB1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia RPS6KB1 33 32
  • 99.94 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia RPS6KB1 33
  • 99 (a)
OneToOne
dog
(Canis familiaris)
Mammalia RPS6KB1 33 32
  • 97.33 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia RPS6KB1 33
  • 97 (a)
OneToOne
cow
(Bos Taurus)
Mammalia RPS6KB1 33 32
  • 96.38 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Rps6kb1 32
  • 95.94 (n)
mouse
(Mus musculus)
Mammalia Rps6kb1 17 33 32
  • 94.6 (n)
chicken
(Gallus gallus)
Aves RPS6KB1 33 32
  • 88.58 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia RPS6KB1 33
  • 95 (a)