This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome... See more...

Aliases for RPN1 Gene

Aliases for RPN1 Gene

  • Ribophorin I 2 3 4 5
  • Dolichyl-Diphosphooligosaccharide--Protein Glycosyltransferase Subunit 1 3 4
  • Oligosaccharyltransferase Complex Subunit (Non-Catalytic) 2 3
  • Ribophorin-1 3 4
  • RPN-I 3 4
  • OST1 2 3
  • Dolichyl-Diphosphooligosaccharide--Protein Glycosyltransferase 67 KDa Subunit 4
  • Dolichyl-Diphosphooligosaccharide-Protein Glycosyltransferase 67 KDa Subunit 3
  • Oligosaccharyltransferase 1 Homolog (S. Cerevisiae) 2
  • Oligosaccharyltransferase 1 Homolog 3
  • EC 2.4.1.119 50
  • RBPH1 3
  • RPN1 5

External Ids for RPN1 Gene

Previous GeneCards Identifiers for RPN1 Gene

  • GC03M125171
  • GC03M128535
  • GC03M129620
  • GC03M129659
  • GC03M129821
  • GC03M128338
  • GC03M125722

Summaries for RPN1 Gene

Entrez Gene Summary for RPN1 Gene

  • This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. [provided by RefSeq, Jul 2008]

GeneCards Summary for RPN1 Gene

RPN1 (Ribophorin I) is a Protein Coding gene. Diseases associated with RPN1 include Acute Myeloid Leukemia With Inv3(P21;Q26.2) Or T(3;3)(P21;Q26.2) and Granulomatous Disease, Chronic, Autosomal Recessive, 1. Among its related pathways are Viral mRNA Translation and Protein processing in endoplasmic reticulum. Gene Ontology (GO) annotations related to this gene include dolichyl-diphosphooligosaccharide-protein glycotransferase activity.

UniProtKB/Swiss-Prot Summary for RPN1 Gene

  • Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

Gene Wiki entry for RPN1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for RPN1 Gene

Genomics for RPN1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for RPN1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around RPN1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for RPN1

Top Transcription factor binding sites by QIAGEN in the RPN1 gene promoter:
  • Evi-1
  • MIF-1
  • Pax-6
  • PPAR-gamma1
  • PPAR-gamma2
  • Roaz
  • XBP-1
  • YY1
  • Zic1
  • ZIC2

Genomic Locations for RPN1 Gene

Latest Assembly
chr3:128,619,969-128,681,075
(GRCh38/hg38)
Size:
61,107 bases
Orientation:
Minus strand

Previous Assembly
chr3:128,338,812-128,369,661
(GRCh37/hg19 by Entrez Gene)
Size:
30,850 bases
Orientation:
Minus strand

chr3:128,338,817-128,399,918
(GRCh37/hg19 by Ensembl)
Size:
61,102 bases
Orientation:
Minus strand

Genomic View for RPN1 Gene

Genes around RPN1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RPN1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RPN1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RPN1 Gene

Proteins for RPN1 Gene

  • Protein details for RPN1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P04843-RPN1_HUMAN
    Recommended name:
    Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
    Protein Accession:
    P04843
    Secondary Accessions:
    • B2R5Z0
    • D3DNB6
    • Q68DT1

    Protein attributes for RPN1 Gene

    Size:
    607 amino acids
    Molecular mass:
    68569 Da
    Quaternary structure:
    • Component of the oligosaccharyltransferase (OST) complex. OST exists in two different complex forms which contain common core subunits RPN1, RPN2, OST48, OST4, DAD1 and TMEM258, either STT3A or STT3B as catalytic subunits, and form-specific accessory subunits (PubMed:23606741, PubMed:25135935). STT3A complex assembly occurs through the formation of 3 subcomplexes. Subcomplex 1 contains RPN1 and TMEM258, subcomplex 2 contains the STT3A-specific subunits STT3A, DC2/OSTC, and KCP2 as well as the core subunit OST4, and subcomplex 3 contains RPN2, DAD1, and OST48. The STT3A complex can form stable complexes with the Sec61 complex or with both the Sec61 and TRAP complexes (By similarity).

    Three dimensional structures from OCA and Proteopedia for RPN1 Gene

neXtProt entry for RPN1 Gene

Selected DME Specific Peptides for RPN1 Gene

P04843:
  • NRYKQSRD
  • EIRPRFPL
  • PGSASSEAPPL
  • GGWKTHY
  • YSQDTFKVH
  • KKNLVEQHIQDIVVHYTFNKVLMLQEPLLVVAAFYILFF
  • LPVALDPGAKISV
  • EHKALTSE
  • RLAHLGVQ
  • MRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVP
  • DSPYEISRAPDELHYTYLDTFGRPVIVA
  • EVSHWGN
  • STLNSGKKSLE

Post-translational modifications for RPN1 Gene

  • Ufmylated by UFL1 in response to endoplasmic reticulum stress, promoting reticulophagy of endoplasmic reticulum sheets.
  • Glycosylation at Asn299
  • Ubiquitination at Lys187, Lys281, Lys474, Lys488, Lys538, Lys553, and Lys559
  • Modification sites at PhosphoSitePlus
  • Glycosylation from GlyConnect

Other Protein References for RPN1 Gene

Domains & Families for RPN1 Gene

Gene Families for RPN1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Plasma proteins
  • Predicted membrane proteins

Protein Domains for RPN1 Gene

InterPro:
Blocks:
  • Ribophorin I

Suggested Antigen Peptide Sequences for RPN1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ51908, highly similar to Dolichyl-diphosphooligosaccharide--proteinglycosyltransferase 67 kDa subunit (EC 2.4.1.119) (B4DNJ5_HUMAN)
  • cDNA FLJ50809, highly similar to Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit (EC 2.4.1.119) (B7Z4L4_HUMAN)
  • RPN1 protein (Q6IBR0_HUMAN)
  • Ribophorin-1 (RPN1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P04843

UniProtKB/Swiss-Prot:

RPN1_HUMAN :
  • Belongs to the OST1 family.
Family:
  • Belongs to the OST1 family.
genes like me logo Genes that share domains with RPN1: view

Function for RPN1 Gene

Molecular function for RPN1 Gene

UniProtKB/Swiss-Prot Function:
Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.
GENATLAS Biochemistry:
breakpoint,downstream of ribophorin 1 in acute myelodysplastic leukemia in particular dysmegakaryocytopoiesis with inv3(q21;q26) or t(3;3)(q21;q26),or t(1;3)(p36-q21)
GENATLAS Biochemistry:
ribophorin I,68.6kDa,component with RPN2 and DDOST,of N-oligosaccharyl transferase

Enzyme Numbers (IUBMB) for RPN1 Gene

Phenotypes From GWAS Catalog for RPN1 Gene

Gene Ontology (GO) - Molecular Function for RPN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003723 RNA binding HDA 22658674
GO:0004579 contributes_to dolichyl-diphosphooligosaccharide-protein glycotransferase activity TAS 15835887
GO:0005515 protein binding IPI 19167329
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with RPN1: view
genes like me logo Genes that share phenotypes with RPN1: view

miRNA for RPN1 Gene

miRTarBase miRNAs that target RPN1

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RPN1

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for RPN1 Gene

Localization for RPN1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RPN1 Gene

Endoplasmic reticulum. Endoplasmic reticulum membrane. Single-pass type I membrane protein. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RPN1 gene
Compartment Confidence
endoplasmic reticulum 5
cytosol 4
plasma membrane 2
extracellular 2
nucleus 2
golgi apparatus 2
cytoskeleton 1
mitochondrion 1
endosome 1
lysosome 1
peroxisome 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (4)
  • Endoplasmic reticulum (4)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for RPN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA,IDA --
GO:0005789 endoplasmic reticulum membrane IEA,TAS --
GO:0005791 rough endoplasmic reticulum IEA,ISS --
GO:0005829 cytosol IDA --
GO:0008250 oligosaccharyltransferase complex IEA,TAS 15835887
genes like me logo Genes that share ontologies with RPN1: view

Pathways & Interactions for RPN1 Gene

genes like me logo Genes that share pathways with RPN1: view

Pathways by source for RPN1 Gene

UniProtKB/Swiss-Prot P04843-RPN1_HUMAN

  • Pathway: Protein modification; protein glycosylation.

SIGNOR curated interactions for RPN1 Gene

Activates:

Gene Ontology (GO) - Biological Process for RPN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006464 cellular protein modification process TAS 10660554
GO:0006486 protein glycosylation IEA --
GO:0006487 protein N-linked glycosylation IDA 9642163
GO:0018279 protein N-linked glycosylation via asparagine IBA,TAS 15835887
genes like me logo Genes that share ontologies with RPN1: view

Drugs & Compounds for RPN1 Gene

(2) Drugs for RPN1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Asparagine Approved, Investigational Nutra 40

(2) Additional Compounds for RPN1 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Dolichyl diphosphate
  • Dolichol diphosphate
  • Dolichol diphosphoric acid
  • Dolichyl diphosphoric acid
  • Dolichol pyrophosphate
  • Dolichyl pyrophosphate
37247-98-6
genes like me logo Genes that share compounds with RPN1: view

Transcripts for RPN1 Gene

mRNA/cDNA for RPN1 Gene

1 REFSEQ mRNAs :
12 NCBI additional mRNA sequence :
8 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RPN1

Alternative Splicing Database (ASD) splice patterns (SP) for RPN1 Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5 ^ 6 ^ 7a · 7b · 7c · 7d ^ 8a · 8b ^ 9a · 9b · 9c · 9d ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14a · 14b
SP1: - - - - - -
SP2: -
SP3: -
SP4: - - - - - - - - - - -
SP5: - - -
SP6: - - -
SP7: - -
SP8: - - - - - -
SP9: -
SP10: -
SP11:

Relevant External Links for RPN1 Gene

GeneLoc Exon Structure for
RPN1

Expression for RPN1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for RPN1 Gene

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for RPN1 Gene



Protein tissue co-expression partners for RPN1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for RPN1

SOURCE GeneReport for Unigene cluster for RPN1 Gene:

Hs.518244

mRNA Expression by UniProt/SwissProt for RPN1 Gene:

P04843-RPN1_HUMAN
Tissue specificity: Expressed in all tissues tested.

Evidence on tissue expression from TISSUES for RPN1 Gene

  • Nervous system(5)
  • Liver(4.7)
  • Kidney(4)
  • Skin(3.7)
  • Intestine(3.6)
  • Lung(3.3)
  • Muscle(3.3)
  • Blood(2.8)
  • Pancreas(2.8)
  • Heart(2.7)
  • Stomach(2.7)
  • Eye(2.4)
  • Thyroid gland(2)
  • Spleen(2)
genes like me logo Genes that share expression patterns with RPN1: view

Primer products for research

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for RPN1 Gene

Orthologs for RPN1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for RPN1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia RPN1 29 30
  • 99.73 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia RPN1 29 30
  • 91.93 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Rpn1 29
  • 88.76 (n)
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 30
  • 88 (a)
OneToMany
-- 30
  • 64 (a)
OneToMany
Mouse
(Mus musculus)
Mammalia Rpn1 29 16 30
  • 87.86 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia -- 30
  • 87 (a)
OneToMany
-- 30
  • 79 (a)
OneToMany
Cow
(Bos Taurus)
Mammalia RPN1 29 30
  • 86.71 (n)
OneToMany
-- 30
  • 83 (a)
OneToMany
Chicken
(Gallus gallus)
Aves RPN1 29 30
  • 78.96 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia RPN1 30
  • 81 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia rpn1 29
  • 74.77 (n)
MGC76266 29
African clawed frog
(Xenopus laevis)
Amphibia MGC52808 29
Zebrafish
(Danio rerio)
Actinopterygii rpn1 29 30
  • 69.47 (n)
OneToOne
-- 29
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8469 29
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP010174 29
  • 56.53 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta CG33303 29 30
  • 55.22 (n)
OneToOne
rho-5 31
  • 45 (a)
Worm
(Caenorhabditis elegans)
Secernentea ribo-1 29 30
  • 49.8 (n)
OneToOne
T22D1.4 31
  • 41 (a)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes OST1 30 32
  • 25 (a)
OneToOne
Thale Cress
(Arabidopsis thaliana)
eudicotyledons AT1G76400 29
  • 47.04 (n)
Rice
(Oryza sativa)
Liliopsida Os05g0301500 29
  • 47.45 (n)
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.2016 30
  • 51 (a)
OneToOne
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.4362 29
Species where no ortholog for RPN1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for RPN1 Gene

ENSEMBL:
Gene Tree for RPN1 (if available)
TreeFam:
Gene Tree for RPN1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for RPN1: view image
Alliance of Genome Resources:
Additional Orthologs for RPN1

Paralogs for RPN1 Gene

No data available for Paralogs for RPN1 Gene

Variants for RPN1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for RPN1 Gene

SNP ID Clinical significance and condition Chr 03 pos Variation AA Info Type
rs111781915 Benign: not provided 128,637,856(-) C/T
NM_002950.4(RPN1):c.576G>A (p.Thr192=)
SYNONYMOUS
rs146757242 Benign: not provided 128,625,535(-) T/C
NM_002950.4(RPN1):c.1394A>G (p.Lys465Arg)
MISSENSE
rs150096055 Benign: not provided 128,637,793(-) G/A
NM_002950.4(RPN1):c.633+6C>T
INTRON
rs34781001 Benign: not provided 128,620,588(-) G/A
NM_002950.4(RPN1):c.1647C>T (p.Ser549=)
SYNONYMOUS

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for RPN1 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for RPN1 Gene

Variant ID Type Subtype PubMed ID
dgv36n50 OTHER inversion 21212237
dgv4855n100 CNV gain 25217958
dgv4856n100 CNV gain 25217958
esv2725894 CNV deletion 23290073
esv2759176 CNV loss 17122850
esv2763764 CNV gain+loss 21179565
esv32649 CNV gain 17666407
esv3365174 OTHER inversion 20981092
nsv10319 CNV gain 18304495
nsv3994 CNV insertion 18451855
nsv433360 CNV gain 18776910
nsv508952 CNV insertion 20534489
nsv511200 CNV loss 21212237

Variation tolerance for RPN1 Gene

Residual Variation Intolerance Score: 24% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.00; 49.94% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for RPN1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
RPN1
Leiden Open Variation Database (LOVD)
RPN1

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RPN1 Gene

Disorders for RPN1 Gene

MalaCards: The human disease database

(4) MalaCards diseases for RPN1 Gene - From: ORP and COP

Disorder Aliases PubMed IDs
acute myeloid leukemia with inv3(p21;q26.2) or t(3;3)(p21;q26.2)
  • acute myeloid leukemia with inv(3)(q21q26.2) or t(3;3)(q21;q26.2)
granulomatous disease, chronic, autosomal recessive, 1
  • cgd1
extraosseous osteosarcoma
  • extraskeletal osteogenic sarcoma
autosomal recessive non-syndromic intellectual disability
  • autosomal recessive mental retardation
- elite association - COSMIC cancer census association via MalaCards
Search RPN1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for RPN1

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with RPN1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for RPN1 Gene

Publications for RPN1 Gene

  1. OST4 is a subunit of the mammalian oligosaccharyltransferase required for efficient N-glycosylation. (PMID: 23606741) Dumax-Vorzet A … High S (Journal of cell science 2013) 3 4
  2. Ribophorin I regulates substrate delivery to the oligosaccharyltransferase core. (PMID: 18607003) Wilson CM … High S (Proceedings of the National Academy of Sciences of the United States of America 2008) 3 22
  3. Polymorphisms in mitochondrial genes and prostate cancer risk. (PMID: 19064571) Wang L … Thibodeau SN (Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2008) 3 40
  4. Ribophorin I acts as a substrate-specific facilitator of N-glycosylation. (PMID: 17264154) Wilson CM … High S (Journal of cell science 2007) 3 22
  5. Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. (PMID: 17081065) Chi A … Hunt DF (Journal of proteome research 2006) 3 4

Products for RPN1 Gene

Sources for RPN1 Gene