Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytok... See more...
Aliases for ROCK1 Gene
Aliases for ROCK1 Gene
External Ids for ROCK1 Gene
- HGNC: 10251
- Entrez Gene: 6093
- Ensembl: ENSG00000067900
- OMIM: 601702
- UniProtKB: Q13464
Previous GeneCards Identifiers for ROCK1 Gene
- GC18M018388
- GC18M018263
- GC18M016785
- GC18M016787
- GC18M018529
- GC18M015376
Summaries for ROCK1 Gene
-
This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. A pseudogene, related to this gene, is also located on chromosome 18. [provided by RefSeq, Aug 2015]
GeneCards Summary for ROCK1 Gene
ROCK1 (Rho Associated Coiled-Coil Containing Protein Kinase 1) is a Protein Coding gene. Diseases associated with ROCK1 include Pediatric Osteosarcoma and Hutchinson-Gilford Progeria Syndrome. Among its related pathways are NGF Pathway and Development Slit-Robo signaling. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is ROCK2.
UniProtKB/Swiss-Prot Summary for ROCK1 Gene
-
Protein kinase which is a key regulator of actin cytoskeleton and cell polarity (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579). Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1 and PPP1R12A (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579, PubMed:23093407, PubMed:23355470). Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing (PubMed:18694941). Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress (PubMed:19036714). Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability (By similarity). Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation (PubMed:19181962). Required for centrosome positioning and centrosome-dependent exit from mitosis (By similarity). Plays a role in terminal erythroid differentiation (PubMed:21072057). May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles (By similarity). Promotes keratinocyte terminal differentiation (PubMed:19997641). Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization (By similarity).
-
Rho-kinases (aka Rho-associated coiled-coil kinases or ROCKs) are serine/threonine kinases activated by RhoA GTPases. They are modulators of processes involving cytoskeletal rearrangement such as focal adhesion formation, cell motility and tumor cell invasion.
Additional gene information for ROCK1 Gene
- HGNC(10251)
- Entrez Gene(6093)
- Ensembl(ENSG00000067900)
- OMIM(601702)
- UniProtKB(Q13464)
- Open Targets Platform(ENSG00000067900)
- Monarch Initiative
- Search for ROCK1 at DataMed
- Search for ROCK1 at HumanCyc
No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ROCK1 Gene
Genomics for ROCK1 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for ROCK1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around ROCK1 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ROCK1
- Top Transcription factor binding sites by QIAGEN in the ROCK1 gene promoter:
-
- AREB6
- ARP-1
- Nkx3-1
- Nkx3-1 v1
- Nkx3-1 v2
- Nkx3-1 v3
- Nkx3-1 v4
- NRSF form 1
- NRSF form 2
- Pax-4a
Genomic Locations for ROCK1 Gene
Genomic Locations for ROCK1 Gene
- chr18:20,946,906-21,111,813
- (GRCh38/hg38)
- Size:
- 164,908 bases
- Orientation:
- Minus strand
- chr18:18,526,867-18,691,812
- (GRCh37/hg19)
- Size:
- 164,946 bases
- Orientation:
- Minus strand
Genomic View for ROCK1 Gene
Genes around ROCK1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 18q11.1 by HGNC
- 18q11.1 by Entrez Gene
- 18q11.1 by Ensembl
ROCK1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ROCK1 Gene
Proteins for ROCK1 Gene
-
Protein details for ROCK1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q13464-ROCK1_HUMAN
- Recommended name:
- Rho-associated protein kinase 1
- Protein Accession:
- Q13464
- B0YJ91
- Q2KHM4
- Q59GZ4
Protein attributes for ROCK1 Gene
- Size:
- 1354 amino acids
- Molecular mass:
- 158175 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Quaternary structure:
-
- Homodimer. Interacts with RHOB, RHOC, MYLC2B and PTEN. Interacts with ITGB1BP1 (via N-terminus and PTB domain) (By similarity). Interacts with RHOA (activated by GTP), CHORDC1, DAPK3, GEM, JIP3, RHOE, PPP1R12A, PFN1, LIMK1, LIMK2 and TSG101. Interacts with FHOD1 in a Src-dependent manner. Interacts with SHROOM3 (PubMed:22493320).
Protein Expression for ROCK1 Gene
Selected DME Specific Peptides for ROCK1 Gene
- Q13464:
-
- GHLKLADFGTCMKM
- IFQILYANEGE
- KVIGRGAF
- CDTAVGTPDYISPEVLKSQGGDG
- KEKENRKL
- LLRTESDTA
- SQLANEKL
- GVEEIKRH
- DLDFPALRKNKNIDNFL
- PCKVSYDVTSARDMLLLAC
- EQDKEQS
- FYTAEVVLALDAIHSMG
- VSSKKILFY
- RLEQEVN
- AKNLICAFLTDREVRLGRNGVEEI
- GTPDYISPE
- QDEQKKWVTHLVKKIPK
- KLDKIMKELDEEGNQRRNLES
- FKPPPALEC
- ELQDQLEAEQYFSTLYKTQV
- EMLVGDTPFYADSLVGTYSKIM
- KVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQL
- IHRDVKPDN
- SQLESLNRELQERNR
- VSQIEKEKMLLQHRINEYQRK
- TQLDLAETKAESEQLARG
- MVLDIDKLFHVRPVTQ
- YLYMVMEYMPGGDLVNLMSNYDVPEKWA
- HKGHEFIPTLYHFP
- DLSDSTSVASFPSADETD
- LKDQLEDL
- LQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEIN
- ELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQ
- ERTLKTQAVNKLAEIMNRK
- KEEEISNLKA
- HRDHLDKKEDLI
- ETFPIPKAFVGNQLPF
- SDIEQLR
- LKQSQQK
- FFKNDQW
- SRIEGWLSVPNRGNIKRYGWKKQYVVVSSKK
Post-translational modifications for ROCK1 Gene
- Autophosphorylated on serine and threonine residues.
- Cleaved by caspase-3 during apoptosis. This leads to constitutive activation of the kinase and membrane blebbing.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for ROCK1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- LifeSpan BioSciences Rho Kinase / ROCK1 Antibody (LS-B7100) and Rho Kinase / ROCK1 Antibody (LS-B7892)
- Creative Diagnostics Anti-ROCK1 polyclonal antibody
-
Custom Antibody ServicesOriGene Antibodies for ROCK1
- Novus Biologicals Antibodies for ROCK1
-
Abcam antibodies for ROCK1
- Invitrogen Antibodies for ROCK1 (AFLGC-Rock1)
- antibodies-online: Show 29 available ROCK1 Antibodies ranked by validation data
- Compare Top ROCK1 Antibodies
-
Recommended
- 111 WB Antibodies (anti-mouse)
- 33 IF (p) Antibodies (anti-mouse)
- 2 IHC Antibodies (anti-mouse)
- 1 IF Antibody (anti-mouse)
- 1 IHC (p) Antibody (anti-mouse)
- 101 WB Antibodies (anti-rat)
- 33 IF (p) Antibodies (anti-rat)
- 2 IHC Antibodies (anti-rat)
- 1 IF Antibody (anti-rat)
- 1 IHC (p) Antibody (anti-rat)
- 151 WB Antibodies (anti-human)
- 33 IF (p) Antibodies (anti-human)
- 2 IHC Antibodies (anti-human)
- 2 IHC (p) Antibodies (anti-human)
- 2 IP Antibodies (anti-human)
- 1 IF Antibody (anti-human)
-
Boster Bio Antibodies for ROCK1
-
Custom Antibody ServicesProSci Antibodies for ROCK1
-
Santa Cruz Biotechnology (SCBT) Antibodies for ROCK1
- Sino Biological Antibodies for ROCK1
Protein Products
-
OriGene Purified Proteins for ROCK1
- Search Origene for MassSpec and Protein Over-expression Lysates for ROCK1
- Origene Custom Protein Services for ROCK1
-
Abcam proteins for ROCK1
Assay Products
- antibodies-online: Show 5 available ROCK1 Elisa Kits ranked by validation data
- Compare Top ROCK1 Elisa Kits
-
Quality Products:
-
Signalway ELISA kits for ROCK1
Domains & Families for ROCK1 Gene
Gene Families for ROCK1 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Enzymes
- FDA approved drug targets
- Plasma proteins
- Predicted intracellular proteins
Protein Domains for ROCK1 Gene
- InterPro:
- Blocks:
-
- Protein kinase C-terminal domain
- Pleckstrin-like
- ProtoNet:
Suggested Antigen Peptide Sequences for ROCK1 Gene
- GenScript: Design optimal peptide antigens:
-
- Rho-associated, coiled-coil containing protein kinase 1 (D9ZGF8_HUMAN)
- ROCK1 protein (Q49AA3_HUMAN)
- p160 ROCK-1 (ROCK1_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q13464UniProtKB/Swiss-Prot:
ROCK1_HUMAN :- The C-terminal auto-inhibitory domain interferes with kinase activity. RHOA binding leads to a conformation change and activation of the kinase. Truncated ROCK1 is constitutively activated.
- Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
- Domain:
-
- The C-terminal auto-inhibitory domain interferes with kinase activity. RHOA binding leads to a conformation change and activation of the kinase. Truncated ROCK1 is constitutively activated.
- Family:
-
- Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Function for ROCK1 Gene
Molecular function for ROCK1 Gene
- UniProtKB/Swiss-Prot Function:
- Protein kinase which is a key regulator of actin cytoskeleton and cell polarity (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579). Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1 and PPP1R12A (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579, PubMed:23093407, PubMed:23355470). Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing (PubMed:18694941). Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress (PubMed:19036714). Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability (By similarity). Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation (PubMed:19181962). Required for centrosome positioning and centrosome-dependent exit from mitosis (By similarity). Plays a role in terminal erythroid differentiation (PubMed:21072057). May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles (By similarity). Promotes keratinocyte terminal differentiation (PubMed:19997641). Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization (By similarity).
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:10436159, ECO:0000269|PubMed:10652353, ECO:0000269|PubMed:11018042, ECO:0000269|PubMed:23093407, ECO:0000269|PubMed:23355470};.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:10436159, ECO:0000269|PubMed:10652353, ECO:0000269|PubMed:11018042, ECO:0000269|PubMed:23093407, ECO:0000269|PubMed:23355470};.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Activated by RHOA binding. Inhibited by Y-27632.
Enzyme Numbers (IUBMB) for ROCK1 Gene
Phenotypes From GWAS Catalog for ROCK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0004672 | protein kinase activity | IEA,TAS | 8798490 |
| GO:0004674 | protein serine/threonine kinase activity | IEA,TAS | -- |
| GO:0005515 | protein binding | IPI | 10652353 |
| GO:0005524 | ATP binding | IEA | -- |
Phenotypes for ROCK1 Gene
- MGI mutant phenotypes for ROCK1:
-
inferred from 7 alleles
- nervous system phenotype
- immune system phenotype
- respiratory system phenotype
- cardiovascular system phenotype
- cellular phenotype
- behavior/neurological phenotype
- mortality/aging
- muscle phenotype
- homeostasis/metabolism phenotype
- growth/size/body region phenotype
- renal/urinary system phenotype
- vision/eye phenotype
- skeleton phenotype
- hematopoietic system phenotype
- integument phenotype
- adipose tissue phenotype
- GenomeRNAi human phenotypes for ROCK1:
-
- Increased vaccinia virus (VACV) infection
- no effect
- Increased G1 DNA content
- Negative genetic interaction between KRASG13D/+ and KRAS+/-
- Decreased cell migration
- Increased Nanog expression
- Increased epidermal growth factor receptor (EGFR) surface abundance
- Decreased viability
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Increased homologous recombination repair frequency
- Increased cell viability after pRB stimulation
- G0/1 arrest
- Decreased epidermal growth factor (EGF) endocytosis
- Increased senescence-associated beta-galactosidase protein expression after pRB stimulation
- Decreased substrate adherent cell growth
- Decreased focal adhesion (FA) area, decreased FA length, decreased FA mean intensity, increased number of small and round FAs, decreased FA abundance, increased peripheral FA formation, increased cell spreading
- Condensed cis-Golgi
- Increased telomerase activity
Animal Models for ROCK1 Gene
Animal Model Products
-
Taconic Biosciences Mouse Models for ROCK1
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ROCK1 - Select products 50% OFF >
- * ROCK1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for ROCK1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ROCK1
-
Santa Cruz Biotechnology (SCBT) CRISPR for ROCK1
miRNA for ROCK1 Gene
- miRTarBase miRNAs that target ROCK1
-
- hsa-miR-146a-5p (MIRT000945)
- hsa-miR-584-5p (MIRT004047)
- mmu-miR-148a-3p (MIRT006470)
- hsa-miR-124-3p (MIRT006776)
- hsa-miR-1280 (MIRT007070)
- hsa-miR-148b-3p (MIRT007315)
- hsa-miR-335-5p (MIRT053076)
- hsa-miR-148a-3p (MIRT053483)
- hsa-miR-135a-5p (MIRT054402)
- hsa-miR-145-5p (MIRT438282)
- hsa-miR-340-5p (MIRT438654)
- hsa-miR-4662a-5p (MIRT441619)
- hsa-miR-4753-5p (MIRT441620)
- hsa-miR-6507-5p (MIRT441621)
- hsa-miR-6768-3p (MIRT441622)
- hsa-miR-548aw (MIRT494982)
- hsa-miR-5093 (MIRT494983)
- hsa-miR-1468-3p (MIRT494984)
- hsa-miR-548x-5p (MIRT494985)
- hsa-miR-548g-5p (MIRT494986)
- hsa-miR-548f-5p (MIRT494987)
- hsa-miR-548aj-5p (MIRT494988)
- hsa-miR-3688-3p (MIRT494989)
- mmu-miR-494-3p (MIRT731456)
- hsa-miR-300 (MIRT731498)
- hsa-miR-506-3p (MIRT731717)
- hsa-miR-584-3p (MIRT734188)
- hsa-miR-126-3p (MIRT734471)
- hsa-miR-144-5p (MIRT735210)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ROCK1
- Browse OriGene Inhibitory RNA Products For ROCK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ROCK1
Clone Products
- Applied Biological Materials (abm): Clones for ROCK1 - Select products 50% OFF >
- * ROCK1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for ROCK1
- Addgene plasmids for ROCK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ROCK1
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ROCK1 Gene
Localization for ROCK1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ROCK1 Gene
- Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Golgi apparatus membrane. Peripheral membrane protein. Cell projection, bleb. Cytoplasm, cytoskeleton. Cell membrane. Cell projection, lamellipodium. Cell projection, ruffle. Note=Associated with the mother centriole and an intercentriolar linker. Colocalizes with ITGB1BP1 and ITGB1 at the cell membrane predominantly in lamellipodia and membrane ruffles, but also in retraction fibers. Localizes at the cell membrane in an ITGB1BP1-dependent manner (By similarity). A small proportion is associated with Golgi membranes. {ECO:0000250}.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| cytoskeleton | 5 |
| cytosol | 5 |
| plasma membrane | 4 |
| golgi apparatus | 4 |
| mitochondrion | 3 |
| nucleus | 3 |
| endoplasmic reticulum | 2 |
| endosome | 2 |
| lysosome | 2 |
| peroxisome | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | IEA | -- |
| GO:0001726 | ruffle | ISS | -- |
| GO:0005576 | extracellular region | TAS | -- |
| GO:0005737 | cytoplasm | IBA | 21873635 |
| GO:0005794 | Golgi apparatus | IEA | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for ROCK1 Gene
Pathways & Interactions for ROCK1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling | ||
| 2 | Activation of cAMP-Dependent PKA |
Activation of cAMP-Dependent PKA
.77
cAMP Pathway
.77
|
Activation of PKA through GPCR
.71
PKA Signaling
.56
|
| 3 | Apoptotic execution phase |
.31
|
|
| 4 | EPH-Ephrin signaling |
Cytoskeleton remodeling Fibronectin-binding integrins in cell motility
.35
|
|
| 5 | Semaphorin interactions | ||
Pathways by source for ROCK1 Gene
1 Sino Biological pathway for ROCK1 Gene
22 BioSystems pathways for ROCK1 Gene
24 Reactome pathways for ROCK1 Gene
20 KEGG pathways for ROCK1 Gene
13 GeneGo (Thomson Reuters) pathways for ROCK1 Gene
- Cell adhesion Integrin-mediated cell adhesion and migration
- Cytoskeleton remodeling Fibronectin-binding integrins in cell motility
- Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases
- Cytoskeleton remodeling Role of PKA in cytoskeleton reorganisation
- Development MAG-dependent inhibition of neurite outgrowth
5 R&D Systems pathways for ROCK1 Gene
1 Tocris pathway for ROCK1 Gene
28 Qiagen pathways for ROCK1 Gene
- Actin Nucleation by ARP-WASP Complex
- Actin-Based Motility by Rho Family GTPases
- Activation of cAMP-Dependent PKA
- Activation of PKA through GPCR
- Breast Cancer Regulation by Stathmin1
1 Cell Signaling Technology pathway for ROCK1 Gene
3 GeneTex pathways for ROCK1 Gene
Interacting Proteins for ROCK1 Gene
Selected Interacting proteins:
Q13464-ROCK1_HUMAN
ENSP00000382697
for ROCK1 Gene via
UniProtKB
MINT
STRING
IID
GPS-Prot Interaction Network for ROCK1
SIGNOR curated interactions for ROCK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000281 | mitotic cytokinesis | IBA | 21873635 |
| GO:0003180 | aortic valve morphogenesis | ISS | -- |
| GO:0003383 | apical constriction | IEA | -- |
| GO:0006468 | protein phosphorylation | IEA,IDA | 23093407 |
| GO:0006915 | apoptotic process | IEA | -- |
Drugs & Compounds for ROCK1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Netarsudil | Approved | Pharma | Target, inhibitor | 0 | ||
| Hydroxyfasudil | Experimental | Pharma | Target, inhibitor | Rho-kinase inhibitor and vasodilator | 0 | |
| Y-27632 | Experimental | Pharma | Target | ROCK inhibitor,potent and selective | 0 | |
| (S)-2-METHYL-1-[(4-METHYL-5-ISOQUINOLINE)SULFONYL]-HOMOPIPERAZINE | Experimental | Pharma | Target | 0 | ||
| Ripasudil | Experimental | Pharma | Target, inhibitor | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ADP |
|
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist | 58-64-0 | |||
| Diglycerides Group A |
|
|
||||
| Diglycerides Group B |
|
|
||||
| Diglycerides Group C |
|
|
||||
| Diglycerides Group D |
|
|
(5) Tocris Compounds for ROCK1 Gene
| Compound | Action | Cas Number |
|---|---|---|
| Fasudil hydrochloride | Inhibitor of cyclic nucleotide dependent- and Rho-kinases | 105628-07-7 |
| Glycyl-H 1152 dihydrochloride | Selective Rho-kinase (ROCK) inhibitor. More selective analog of H 1152 dihydrochloride (Cat. No. 2414) | 913844-45-8 |
| H 1152 dihydrochloride | Selective Rho-kinase (ROCK) inhibitor | 871543-07-6 |
| HA 1100 hydrochloride | Cell-permeable, selective Rho-kinase inhibitor | 155558-32-0 |
| Y-27632 dihydrochloride | Selective p160ROCK inhibitor | 129830-38-2 |
(17) ApexBio Compounds for ROCK1 Gene
| Compound | Action | Cas Number |
|---|---|---|
| AS 1892802 | ROCK inhibitor,potent and ATP-competitive | 928320-12-1 |
| Fasudil | calcium antagonist | 103745-39-7 |
| Fasudil (HA-1077) HCl | Protein kinase inhibitor | 105628-07-7 |
| GSK269962A | ROCK inhibitor | 850664-21-0 |
| GSK429286A | Selective ROCK1/ROCK2 inhibitor | 864082-47-3 |
| Hydroxyfasudil | Rho-kinase inhibitor and vasodilator | 105628-72-6 |
| Hydroxyfasudil hydrochloride | Rho-kinase inhibitor and vasodilator | 155558-32-0 |
| K-115 | 887375-67-9 | |
| LX7101 HCL | Dual LIM-kinase and ROCK inhibitor | 1192189-69-7 |
| Narciclasine | Modulates the Rho/ROCK/LIM kinase/cofilin pathway | 29477-83-6 |
| RKI-1447 | Potent ROCK1/ROCK2 inhibitor | 1342278-01-6 |
| SB 772077B dihydrochloride | 607373-46-6 | |
| SLx-2119 | Selective ROCK2 inhibitor | 911417-87-3 |
| Thiazovivin | ROCK inhibitor | 1226056-71-8 |
| Y-27632 | ROCK inhibitor,potent and selective | 146986-50-7 |
| Y-27632 dihydrochloride | ROCK1 inhibitor | 146986-50-7, 129830-38-2 |
| Y-39983 dihydrochloride | ROCK family inhibitor | 173897-44-4 |
Transcripts for ROCK1 Gene
mRNA/cDNA for ROCK1 Gene
- 1 REFSEQ mRNAs :
- 7 NCBI additional mRNA sequence :
- 7 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000399799 9446 nts (view in UCSC)
- ENST00000578051 584 nts (view in UCSC)
- ENST00000582445 543 nts (view in UCSC)
- ENST00000583556 672 nts (view in UCSC)
- ENST00000584687 492 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for ROCK1 - Select products 50% OFF >
- * ROCK1 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for ROCK1
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ROCK1
-
Santa Cruz Biotechnology (SCBT) CRISPR for ROCK1
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ROCK1
- Browse OriGene Inhibitory RNA Products For ROCK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ROCK1
Clone Products
- Applied Biological Materials (abm): Clones for ROCK1 - Select products 50% OFF >
- * ROCK1 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
- Sino Biological Human cDNA Clone for ROCK1
- Addgene plasmids for ROCK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ROCK1
Relevant External Links for ROCK1 Gene
- GeneLoc Exon Structure for
- ROCK1
Expression for ROCK1 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Blood (Hematopoietic System)
- pre Conventional Dendritic Cells Peripheral Blood
- Neural Tube (Nervous System)
- Bone (Muscoskeletal System)
mRNA differential expression in normal tissues according to GTEx for ROCK1 Gene
This gene is overexpressed in Artery - Tibial (x4.0).
This gene is overexpressed in Peripheral blood mononuclear cells (15.3) and Lymph node (13.7).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ROCK1 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ROCK1
SOURCE GeneReport for Unigene cluster for ROCK1 Gene:
Hs.306307mRNA Expression by UniProt/SwissProt for ROCK1 Gene:
Q13464-ROCK1_HUMAN
Tissue specificity:
Detected in blood platelets.
Evidence on tissue expression from TISSUES for ROCK1 Gene
- Nervous system(4.8)
- Liver(4.6)
- Blood(3.7)
- Heart(3.5)
- Muscle(3.3)
- Kidney(3.2)
- Eye(3.2)
- Lung(3.1)
- Intestine(3.1)
- Spleen(3.1)
- Bone marrow(2.8)
- Skin(2.7)
- Pancreas(2.7)
- Lymph node(2.7)
- Adrenal gland(2.5)
- Stomach(2.3)
- Gall bladder(2.1)
- Thyroid gland(2)
Primer Products
-
OriGene qPCR primer pairs for ROCK1
Gene Expression Assay Products
No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for ROCK1 Gene
Orthologs for ROCK1 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | ROCK1 30 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | ROCK1 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | ROCK1 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | ROCK1 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Rock1 30 17 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | ROCK1 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Rock1 30 |
|
||
| Chicken (Gallus gallus) |
Aves | ROCK1 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | ROCK1 31 |
|
OneToOne | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | rock1 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | rock1 30 31 |
|
OneToOne | |
| Fruit Fly (Drosophila melanogaster) |
Insecta | rok 32 |
|
|
|
| Worm (Caenorhabditis elegans) |
Secernentea | let-502 32 |
|
|
|
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | CBK1 31 |
|
OneToMany | |
| Sea Vase (Ciona intestinalis) |
Ascidiacea | Cin.501 30 |
|
- Species where no ortholog for ROCK1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Squirt (Ciona savignyi)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for ROCK1 Gene
- ENSEMBL:
- Gene Tree for ROCK1 (if available)
- TreeFam:
- Gene Tree for ROCK1 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for ROCK1: view image
Paralogs for ROCK1 Gene
(33) SIMAP similar genes for ROCK1 Gene using alignment to 4 proteins:
- ROCK1_HUMAN
- D9ZGF8_HUMAN
- J3KRH6_HUMAN
- Q49AA3_HUMAN
Pseudogenes.org Pseudogenes for ROCK1 Gene
Variants for ROCK1 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ROCK1 Gene
| SNP ID | Clinical significance and condition | Chr 18 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 711996 | Benign: not provided | 21,006,451(-) | A/C | SYNONYMOUS_VARIANT | |
| 727646 | Likely Benign: not provided | 21,042,653(-) | T/C | SYNONYMOUS_VARIANT | |
| 769935 | Benign: not provided | 20,970,392(-) | T/G | SYNONYMOUS_VARIANT | |
| 777282 | Benign: not provided | 20,970,516(-) | G/A | INTRON_VARIANT | |
| 777895 | Benign: not provided | 20,984,522(-) | G/C | MISSENSE_VARIANT |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv3324n100 | CNV | gain | 25217958 |
| esv3306568 | CNV | mobile element insertion | 20981092 |
| esv3308855 | CNV | mobile element insertion | 20981092 |
| esv3327515 | CNV | insertion | 20981092 |
| esv3433136 | CNV | insertion | 20981092 |
| esv3437603 | CNV | insertion | 20981092 |
| esv3573920 | CNV | gain | 25503493 |
| esv3641928 | CNV | gain | 21293372 |
| esv3641929 | CNV | gain | 21293372 |
| esv3641931 | CNV | loss | 21293372 |
| nsv833594 | CNV | gain+loss | 17160897 |
| nsv960269 | CNV | duplication | 23825009 |
| nsv960270 | CNV | duplication | 23825009 |
Residual Variation Intolerance Score:
8.32% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.86;
34.83% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for ROCK1 Gene
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ROCK1 Gene
Disorders for ROCK1 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| pediatric osteosarcoma |
|
|
| hutchinson-gilford progeria syndrome |
|
|
| corticobasal degeneration |
|
|
| ocular hyperemia |
|
|
| lung cancer |
|
|
Search ROCK1 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for ROCK1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for ROCK1 Gene
Publications for ROCK1 Gene
- ROCK isoform regulation of myosin phosphatase and contractility in vascular smooth muscle cells. (PMID: 19131646) Wang Y … Surks HK (Circulation research 2009) 3 4 23
- Phosphorylation of profilin by ROCK1 regulates polyglutamine aggregation. (PMID: 18573880) Shao J … Diamond MI (Molecular and cellular biology 2008) 3 4 23
- Different molecular mechanisms for Rho family GTPase-dependent, Ca2+-independent contraction of smooth muscle. (PMID: 9722579) Van Eyk JE … Mak AS (The Journal of biological chemistry 1998) 3 4 23
- The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase. (PMID: 8617235) Ishizaki T … Narumiya S (The EMBO journal 1996) 2 3 4
- Tubulin polymerization promoting protein 1 (Tppp1) phosphorylation by Rho-associated coiled-coil kinase (rock) and cyclin-dependent kinase 1 (Cdk1) inhibits microtubule dynamics to increase cell proliferation. (PMID: 23355470) Schofield AV … Bernard O (The Journal of biological chemistry 2013) 3 4
ExternalLinks
Products for ROCK1 Gene
- Custom Antibody ServicesOriGene Antibodies for ROCK1
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ROCK1
- Search Origene for MassSpec and Protein Over-expression Lysates for ROCK1
- Origene Custom Protein Services for ROCK1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ROCK1
- Browse OriGene Inhibitory RNA Products For ROCK1
- OriGene qPCR primer pairs for ROCK1
- OriGene CRISPR knockouts for ROCK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ROCK1
- Sino Biological Human cDNA Clone for ROCK1
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for ROCK1
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for ROCK1
- Novus Biologicals proteins and lysates for ROCK1
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for ROCK1
- Abcam proteins for ROCK1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for ROCK1
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for ROCK1 (AFLGC-Rock1)
- ApexBio compounds for ROCK1
- VectorBuilder Custom and pre-made DNA vectors for ROCK1 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for ROCK1 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for ROCK1 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for ROCK1 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for ROCK1
- Addgene plasmids for ROCK1
- antibodies-online: Show 29 available ROCK1 Antibodies ranked by validation data
- Compare Top ROCK1 Antibodies
- Recommended
- 111 WB Antibodies (anti-mouse)
- 33 IF (p) Antibodies (anti-mouse)
- 2 IHC Antibodies (anti-mouse)
- 1 IF Antibody (anti-mouse)
- 1 IHC (p) Antibody (anti-mouse)
- 101 WB Antibodies (anti-rat)
- 33 IF (p) Antibodies (anti-rat)
- 2 IHC Antibodies (anti-rat)
- 1 IF Antibody (anti-rat)
- 1 IHC (p) Antibody (anti-rat)
- 151 WB Antibodies (anti-human)
- 33 IF (p) Antibodies (anti-human)
- 2 IHC Antibodies (anti-human)
- 2 IHC (p) Antibodies (anti-human)
- 2 IP Antibodies (anti-human)
- 1 IF Antibody (anti-human)
- antibodies-online: Show 5 available ROCK1 Elisa Kits ranked by validation data
- Compare Top ROCK1 Elisa Kits
- Quality Products:
- antibodies-online: Show 8 available ROCK1 Proteins ranked by validation data
- Compare Top ROCK1 Proteins
- Santa Cruz Biotechnology (SCBT) Antibodies for ROCK1
- Search Santa Cruz Biotechnology (SCBT) for ROCK1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ROCK1
- Custom Antibody ServicesProSci Antibodies for ROCK1
- Search for ROCK1 Proteins at ProSci
- Horizon Cell Lines for ROCK1
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for ROCK1
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for ROCK1
- Search GeneCopoeia for miRNA 3'UTR Target clone products for ROCK1
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ROCK1
- Boster Bio Antibodies for ROCK1
- Browse Boster Bio ELISA Kits
Sources for ROCK1 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177