ROCK1 Gene (Protein Coding)

Rho Associated Coiled-Coil Containing Protein Kinase 1

GC18M020946
GIFtS:
51
This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytok... See more...

Aliases for ROCK1 Gene

Aliases for ROCK1 Gene

  • Rho Associated Coiled-Coil Containing Protein Kinase 1 2 3 5
  • P160ROCK 2 3 4
  • Renal Carcinoma Antigen NY-REN-35 3 4
  • Rho-Associated Protein Kinase 1 3 4
  • P160 ROCK-1 3 4
  • EC 2.7.11.1 4 50
  • ROCK-I 3 4
  • Rho-Associated, Coiled-Coil-Containing Protein Kinase 1 4
  • Rho-Associated, Coiled-Coil-Containing Protein Kinase I 4
  • EC 2.7.11.1'); 50
  • EC 2.7.11 50
  • ROCK1 5

External Ids for ROCK1 Gene

Previous GeneCards Identifiers for ROCK1 Gene

  • GC18M018388
  • GC18M018263
  • GC18M016785
  • GC18M016787
  • GC18M018529
  • GC18M015376

Summaries for ROCK1 Gene

Entrez Gene Summary for ROCK1 Gene

  • This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. A pseudogene, related to this gene, is also located on chromosome 18. [provided by RefSeq, Aug 2015]

GeneCards Summary for ROCK1 Gene

ROCK1 (Rho Associated Coiled-Coil Containing Protein Kinase 1) is a Protein Coding gene. Diseases associated with ROCK1 include Breast Cancer and Pediatric Osteosarcoma. Among its related pathways are Integrin Pathway and Proteoglycans in cancer. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is ROCK2.

UniProtKB/Swiss-Prot Summary for ROCK1 Gene

  • Protein kinase which is a key regulator of the actin cytoskeleton and cell polarity (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579). Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1 and PPP1R12A (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579, PubMed:23093407, PubMed:23355470). Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing (PubMed:18694941). Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress (PubMed:19036714). Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability (By similarity). Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation (PubMed:19181962). Required for centrosome positioning and centrosome-dependent exit from mitosis (By similarity). Plays a role in terminal erythroid differentiation (PubMed:21072057). Inhibits podocyte motility via regulation of actin cytoskeletal dynamics and phosphorylation of CFL1 (By similarity). Promotes keratinocyte terminal differentiation (PubMed:19997641). Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization (By similarity). May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles (By similarity).

Tocris Summary for ROCK1 Gene

  • Rho-kinases (aka Rho-associated coiled-coil kinases or ROCKs) are serine/threonine kinases activated by RhoA GTPases. They are modulators of processes involving cytoskeletal rearrangement such as focal adhesion formation, cell motility and tumor cell invasion.

Gene Wiki entry for ROCK1 Gene

Additional gene information for ROCK1 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for ROCK1 Gene

Genomics for ROCK1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Download GeneHancer 2017 data
Promoters and enhancers for ROCK1 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH18J021109 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 262.7 +1.6 1612 6.4 ZNF207 ZNF600 POLR2A ZBTB10 YY1 CTCF REST CEBPB SMAD5 FEZF1 ROCK1 lnc-GREB1L-2 ESCO1 lnc-ROCK1-4 MK280144-297
GH18J022106 Enhancer 1.2 Ensembl ENCODE dbSUPER 9.8 -994.9 -994932 1.1 IKZF1 ATF3 YY1 CEBPB MAX EP300 MAFF FOXA2 RXRA RAD21 ESCO1 ENSG00000264188 ROCK1 piR-48759-141 ENSG00000263588 GATA6 GATA6-AS1 MIB1
GH18J021051 Enhancer 0.8 Ensembl ENCODE 10.9 +57.0 57012 11.6 CEBPA JUND ELF1 HNF4A MAFK NFIL3 ZNF384 HLF ATF3 FOS ROCK1 MIB1 HSALNG0120299 lnc-ESCO1-3 piR-50444-194 lnc-ROCK1-4
GH18J021134 Enhancer 0.6 Ensembl 11.5 -23.0 -22988 1.6 ZNF654 CEBPA CEBPB CTCF RAD21 SMC3 HNF4A CEBPG ZNF507 RXRA ESCO1 MIB1 ROCK1 piR-53431-303 piR-60501 GREB1L
GH18J021141 Enhancer 0.4 Ensembl ENCODE 11.5 -30.3 -30341 1.1 CEBPB ROCK1 ABHD3 piR-55627-054 RF00017-2371 LOC107985161 ENSG00000265984 HSALNG0120302 GREB1L
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around ROCK1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for ROCK1

Top Transcription factor binding sites by QIAGEN in the ROCK1 gene promoter:
  • AREB6
  • ARP-1
  • Nkx3-1
  • Nkx3-1 v1
  • Nkx3-1 v2
  • Nkx3-1 v3
  • Nkx3-1 v4
  • NRSF form 1
  • NRSF form 2
  • Pax-4a

Genomic Locations for ROCK1 Gene

Latest Assembly
chr18:20,946,906-21,111,813
(GRCh38/hg38)
Size:
164,908 bases
Orientation:
Minus strand

Previous Assembly
chr18:18,526,867-18,691,774
(GRCh37/hg19 by Entrez Gene)
Size:
164,908 bases
Orientation:
Minus strand

chr18:18,526,867-18,691,812
(GRCh37/hg19 by Ensembl)
Size:
164,946 bases
Orientation:
Minus strand

Genomic View for ROCK1 Gene

Genes around ROCK1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ROCK1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ROCK1 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for ROCK1 Gene

Proteins for ROCK1 Gene

Products:

  1. Antibodies for research
  2. Protein products for research
  3. Assay products for research

  • Protein details for ROCK1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13464-ROCK1_HUMAN
    Recommended name:
    Rho-associated protein kinase 1
    Protein Accession:
    Q13464
    Secondary Accessions:
    • B0YJ91
    • Q2KHM4
    • Q59GZ4

    Protein attributes for ROCK1 Gene

    Size:
    1354 amino acids
    Molecular mass:
    158175 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer. Interacts with RHOB, RHOC, MYLC2B and PTEN. Interacts with ITGB1BP1 (via N-terminus and PTB domain) (By similarity). Interacts with RHOA (activated by GTP), CHORDC1, DAPK3, GEM, JIP3, RHOE, PPP1R12A, PFN1, LIMK1, LIMK2 and TSG101. Interacts with FHOD1 in a Src-dependent manner. Interacts with SHROOM3 (PubMed:22493320).

    Three dimensional structures from OCA and Proteopedia for ROCK1 Gene

neXtProt entry for ROCK1 Gene

Protein Expression for ROCK1 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for ROCK1 Gene

Q13464:
  • GHLKLADFGTCMKM
  • IFQILYANEGE
  • KVIGRGAF
  • CDTAVGTPDYISPEVLKSQGGDG
  • KEKENRKL
  • LLRTESDTA
  • SQLANEKL
  • GVEEIKRH
  • DLDFPALRKNKNIDNFL
  • PCKVSYDVTSARDMLLLAC
  • EQDKEQS
  • FYTAEVVLALDAIHSMG
  • VSSKKILFY
  • RLEQEVN
  • AKNLICAFLTDREVRLGRNGVEEI
  • GTPDYISPE
  • QDEQKKWVTHLVKKIPK
  • KLDKIMKELDEEGNQRRNLES
  • FKPPPALEC
  • ELQDQLEAEQYFSTLYKTQV
  • EMLVGDTPFYADSLVGTYSKIM
  • KVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQL
  • IHRDVKPDN
  • SQLESLNRELQERNR
  • VSQIEKEKMLLQHRINEYQRK
  • TQLDLAETKAESEQLARG
  • MVLDIDKLFHVRPVTQ
  • YLYMVMEYMPGGDLVNLMSNYDVPEKWA
  • HKGHEFIPTLYHFP
  • DLSDSTSVASFPSADETD
  • LKDQLEDL
  • LQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEIN
  • ELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQ
  • ERTLKTQAVNKLAEIMNRK
  • KEEEISNLKA
  • HRDHLDKKEDLI
  • ETFPIPKAFVGNQLPF
  • SDIEQLR
  • LKQSQQK
  • FFKNDQW
  • SRIEGWLSVPNRGNIKRYGWKKQYVVVSSKK

Post-translational modifications for ROCK1 Gene

  • Autophosphorylated on serine and threonine residues.
  • Cleaved by caspase-3 during apoptosis. This leads to constitutive activation of the kinase and membrane blebbing.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for ROCK1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibodies for research

  • Abcam antibodies for ROCK1

Domains & Families for ROCK1 Gene

Gene Families for ROCK1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for ROCK1 Gene

InterPro:
Blocks:
  • Protein kinase C-terminal domain
  • Pleckstrin-like

Suggested Antigen Peptide Sequences for ROCK1 Gene

GenScript: Design optimal peptide antigens:
  • Rho-associated, coiled-coil containing protein kinase 1 (D9ZGF8_HUMAN)
  • ROCK1 protein (Q49AA3_HUMAN)
  • p160 ROCK-1 (ROCK1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q13464

UniProtKB/Swiss-Prot:

ROCK1_HUMAN :
  • The C-terminal auto-inhibitory domain interferes with kinase activity. RHOA binding leads to a conformation change and activation of the kinase. Truncated ROCK1 is constitutively activated.
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Domain:
  • The C-terminal auto-inhibitory domain interferes with kinase activity. RHOA binding leads to a conformation change and activation of the kinase. Truncated ROCK1 is constitutively activated.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
genes like me logo Genes that share domains with ROCK1: view

Function for ROCK1 Gene

Products:

  1. Animal Models for research
  2. CRISPR products for research
  3. miRNA products for research
  4. Inhibitory RNAs for research
  5. Clone products for research
  6. Cell Lines for research

Molecular function for ROCK1 Gene

UniProtKB/Swiss-Prot Function:
Protein kinase which is a key regulator of the actin cytoskeleton and cell polarity (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579). Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1 and PPP1R12A (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579, PubMed:23093407, PubMed:23355470). Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing (PubMed:18694941). Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress (PubMed:19036714). Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability (By similarity). Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation (PubMed:19181962). Required for centrosome positioning and centrosome-dependent exit from mitosis (By similarity). Plays a role in terminal erythroid differentiation (PubMed:21072057). Inhibits podocyte motility via regulation of actin cytoskeletal dynamics and phosphorylation of CFL1 (By similarity). Promotes keratinocyte terminal differentiation (PubMed:19997641). Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization (By similarity). May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:10436159, ECO:0000269|PubMed:10652353, ECO:0000269|PubMed:11018042, ECO:0000269|PubMed:23093407, ECO:0000269|PubMed:23355470};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1; Evidence={ECO:0000269|PubMed:10436159, ECO:0000269|PubMed:10652353, ECO:0000269|PubMed:11018042, ECO:0000269|PubMed:23093407, ECO:0000269|PubMed:23355470};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by RHOA binding. Inhibited by Y-27632.

Enzyme Numbers (IUBMB) for ROCK1 Gene

Phenotypes From GWAS Catalog for ROCK1 Gene

Gene Ontology (GO) - Molecular Function for ROCK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA,TAS 8798490
GO:0004674 protein serine/threonine kinase activity IEA,TAS --
GO:0005515 protein binding IPI 10652353
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with ROCK1: view
genes like me logo Genes that share phenotypes with ROCK1: view

Animal Models for ROCK1 Gene

MGI Knock Outs for ROCK1:

Animal Models for research

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ROCK1

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ROCK1 Gene

Localization for ROCK1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ROCK1 Gene

Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Golgi apparatus membrane. Peripheral membrane protein. Cell projection, bleb. Cytoplasm, cytoskeleton. Cell membrane. Cell projection, lamellipodium. Cell projection, ruffle. Note=A small proportion is associated with Golgi membranes (PubMed:12773565). Associated with the mother centriole and an intercentriolar linker (By similarity). Colocalizes with ITGB1BP1 and ITGB1 at the cell membrane predominantly in lamellipodia and membrane ruffles, but also in retraction fibers (By similarity). Localizes at the cell membrane in an ITGB1BP1-dependent manner (By similarity). {ECO:0000250 UniProtKB:P70335, ECO:0000269 PubMed:12773565}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ROCK1 gene
Compartment Confidence
cytoskeleton 5
cytosol 5
plasma membrane 4
extracellular 4
golgi apparatus 4
nucleus 3
mitochondrion 2
endoplasmic reticulum 2
endosome 2
lysosome 2
peroxisome 1

Gene Ontology (GO) - Cellular Components for ROCK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane IEA --
GO:0001726 ruffle ISS --
GO:0005576 extracellular region TAS --
GO:0005737 cytoplasm IEA,IBA 21873635
GO:0005794 Golgi apparatus IEA --
genes like me logo Genes that share ontologies with ROCK1: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for ROCK1 Gene

Pathways & Interactions for ROCK1 Gene

genes like me logo Genes that share pathways with ROCK1: view

Pathways by source for ROCK1 Gene

1 Sino Biological pathway for ROCK1 Gene
13 GeneGo (Thomson Reuters) pathways for ROCK1 Gene
  • Cell adhesion Integrin-mediated cell adhesion and migration
  • Cytoskeleton remodeling Fibronectin-binding integrins in cell motility
  • Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases
  • Cytoskeleton remodeling Role of PKA in cytoskeleton reorganisation
  • Development MAG-dependent inhibition of neurite outgrowth
1 Tocris pathway for ROCK1 Gene
28 Qiagen pathways for ROCK1 Gene
  • Actin Nucleation by ARP-WASP Complex
  • Actin-Based Motility by Rho Family GTPases
  • Activation of cAMP-Dependent PKA
  • Activation of PKA through GPCR
  • Breast Cancer Regulation by Stathmin1
1 Cell Signaling Technology pathway for ROCK1 Gene
3 GeneTex pathways for ROCK1 Gene

SIGNOR curated interactions for ROCK1 Gene

Activates:
Inactivates:
Is activated by:
Other effect:

Gene Ontology (GO) - Biological Process for ROCK1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000281 mitotic cytokinesis IBA 21873635
GO:0003180 aortic valve morphogenesis ISS --
GO:0006468 protein phosphorylation IEA,IDA 23093407
GO:0006915 apoptotic process IEA --
GO:0006939 smooth muscle contraction TAS 12778124
genes like me logo Genes that share ontologies with ROCK1: view

Drugs & Compounds for ROCK1 Gene

Products:

  1. Drug products for research

(29) Drugs for ROCK1 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Netarsudil Approved Pharma Target, inhibitor 0
Hydroxyfasudil Experimental Pharma Target, inhibitor Rho-kinase inhibitor and vasodilator 0
Y-27632 Experimental Pharma Target ROCK inhibitor,potent and selective 0
(S)-2-METHYL-1-[(4-METHYL-5-ISOQUINOLINE)SULFONYL]-HOMOPIPERAZINE Experimental Pharma Target 0
Ripasudil Experimental Pharma Target, inhibitor 0

(12) Additional Compounds for ROCK1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
 58-64-0
DG(16:0/24:0/0:0)
  • 1-Palmitoyl-2-lignoceroyl-sn-glycerol
  • DAG(16:0/24:0)
  • DAG(40:0)
  • DG(16:0/24:0)
  • DG(40:0)
Diglycerides Group A
  • (2R)-2-Hydroxy-3-(pentadecanoyloxy)propyl (11Z)-icos-11-enoic acid
  • Diacylglycerol(15:0/0:0/20:1)
  • DAG(35:1)
  • Diacylglycerol(35:1)
  • DG(15:0/0:0/20:1W9)
Diglycerides Group B
  • Diglyceride
  • DG(32:4)
  • DG(14:1/18:3)
  • DAG(14:1/18:3)
  • Diacylglycerol(32:4)
 257891-89-7
Diglycerides Group C
  • (2S)-1-Hydroxy-3-(palmitoyloxy)propan-2-yl (5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoate
  • 1,2-DG 16:0/20:4(omega-6)
  • 1-Hexadecanoyl-2-(5Z,8Z,11Z,14Z)-icosatetraenoyl-sn-glycerol
  • 1-Hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycerol
  • DAG(16:0/20:4)
 91125-76-7, 29541-66-0, 51621-26-2

(5) Tocris Compounds for ROCK1 Gene

Compound Action Cas Number
Fasudil hydrochloride Inhibitor of cyclic nucleotide dependent- and Rho-kinases 105628-07-7
Glycyl-H 1152 dihydrochloride Selective Rho-kinase (ROCK) inhibitor. More selective analog of H 1152 dihydrochloride (Cat. No. 2414) 913844-45-8
H 1152 dihydrochloride Selective Rho-kinase (ROCK) inhibitor 871543-07-6
HA 1100 hydrochloride Cell-permeable, selective Rho-kinase inhibitor 155558-32-0
Y-27632 dihydrochloride Selective p160ROCK inhibitor 129830-38-2

(17) ApexBio Compounds for ROCK1 Gene

Compound Action Cas Number
AS 1892802 ROCK inhibitor,potent and ATP-competitive 928320-12-1
Fasudil calcium antagonist 103745-39-7
Fasudil (HA-1077) HCl Protein kinase inhibitor 105628-07-7
GSK269962A ROCK inhibitor 850664-21-0
GSK429286A Selective ROCK1/ROCK2 inhibitor 864082-47-3
Hydroxyfasudil Rho-kinase inhibitor and vasodilator 105628-72-6
Hydroxyfasudil hydrochloride Rho-kinase inhibitor and vasodilator 155558-32-0
K-115 887375-67-9
LX7101 HCL Dual LIM-kinase and ROCK inhibitor 1192189-69-7
Narciclasine Modulates the Rho/ROCK/LIM kinase/cofilin pathway 29477-83-6
RKI-1447 Potent ROCK1/ROCK2 inhibitor 1342278-01-6
SB 772077B dihydrochloride 607373-46-6
SLx-2119 Selective ROCK2 inhibitor 911417-87-3
Thiazovivin ROCK inhibitor 1226056-71-8
Y-27632 ROCK inhibitor,potent and selective 146986-50-7
Y-27632 dihydrochloride ROCK1 inhibitor 146986-50-7, 129830-38-2
Y-39983 dihydrochloride ROCK family inhibitor 173897-44-4
genes like me logo Genes that share compounds with ROCK1: view

Drug products for research

Transcripts for ROCK1 Gene

Products:

  1. CRISPR products for research
  2. miRNA products for research
  3. Inhibitory RNAs for research
  4. Clone products for research

mRNA/cDNA for ROCK1 Gene

1 REFSEQ mRNAs :
7 NCBI additional mRNA sequence :
7 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for ROCK1

Alternative Splicing Database (ASD) splice patterns (SP) for ROCK1 Gene

No ASD Table

Relevant External Links for ROCK1 Gene

GeneLoc Exon Structure for
ROCK1

Expression for ROCK1 Gene

Products:

  1. Primer products for research
  2. Gene Expression Assays for research

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for ROCK1 Gene

mRNA expression in normal human tissues for ROCK1 Gene
mRNA expression by BioGPS for ROCK1 GenemRNA expression by GTEx for ROCK1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for ROCK1 Gene

This gene is overexpressed in Artery - Tibial (x4.0).

Protein differential expression in normal tissues from HIPED for ROCK1 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (15.3) and Lymph node (13.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for ROCK1 Gene



Protein tissue co-expression partners for ROCK1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for ROCK1

SOURCE GeneReport for Unigene cluster for ROCK1 Gene:

Hs.306307

mRNA Expression by UniProt/SwissProt for ROCK1 Gene:

Q13464-ROCK1_HUMAN
Tissue specificity: Detected in blood platelets.

Evidence on tissue expression from TISSUES for ROCK1 Gene

  • Nervous system(4.8)
  • Liver(4.6)
  • Blood(3.5)
  • Heart(3.3)
  • Muscle(3.1)
  • Kidney(3.1)
  • Eye(3)
  • Lung(3)
  • Spleen(3)
  • Intestine(3)
  • Bone marrow(2.7)
  • Pancreas(2.6)
  • Lymph node(2.5)
  • Skin(2.5)
  • Adrenal gland(2.4)
  • Stomach(2.2)
  • Gall bladder(2.1)
genes like me logo Genes that share expression patterns with ROCK1: view

Primer products for research

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for ROCK1 Gene

Orthologs for ROCK1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for ROCK1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
 Mammalia ROCK1 29 30
  • 99.75 (n)
 OneToOne
Platypus
(Ornithorhynchus anatinus)
 Mammalia ROCK1 30
  • 98 (a)
 OneToOne
Dog
(Canis familiaris)
 Mammalia ROCK1 29 30
  • 94.68 (n)
 OneToOne
Cow
(Bos Taurus)
 Mammalia ROCK1 29 30
  • 93.82 (n)
 OneToOne
Mouse
(Mus musculus)
 Mammalia Rock1 29 16 30
  • 92.05 (n)
 OneToOne
Oppossum
(Monodelphis domestica)
 Mammalia ROCK1 30
  • 92 (a)
 OneToOne
Rat
(Rattus norvegicus)
 Mammalia Rock1 29
  • 91.73 (n)
Chicken
(Gallus gallus)
 Aves ROCK1 29 30
  • 81.69 (n)
 OneToOne
Lizard
(Anolis carolinensis)
 Reptilia ROCK1 30
  • 87 (a)
 OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
 Amphibia rock1 29
  • 76.8 (n)
Zebrafish
(Danio rerio)
 Actinopterygii rock1 29 30
  • 69.04 (n)
 OneToOne
Fruit Fly
(Drosophila melanogaster)
 Insecta rok 31
  • 43 (a)
Worm
(Caenorhabditis elegans)
 Secernentea let-502 31
  • 34 (a)
Baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes CBK1 30
  • 22 (a)
 OneToMany
Sea Vase
(Ciona intestinalis)
 Ascidiacea Cin.501 29
Species where no ortholog for ROCK1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for ROCK1 Gene

ENSEMBL:
Gene Tree for ROCK1 (if available)
TreeFam:
Gene Tree for ROCK1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for ROCK1: view image
Alliance of Genome Resources:
Additional Orthologs for ROCK1

Paralogs for ROCK1 Gene

Paralogs for ROCK1 Gene

(33) SIMAP similar genes for ROCK1 Gene using alignment to 4 proteins:

  • ROCK1_HUMAN
  • D9ZGF8_HUMAN
  • J3KRH6_HUMAN
  • Q49AA3_HUMAN

Pseudogenes.org Pseudogenes for ROCK1 Gene

genes like me logo Genes that share paralogs with ROCK1: view

Variants for ROCK1 Gene

Products:

  1. SNP Genotyping and Copy Number Assays for research

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for ROCK1 Gene

SNP ID Clinical significance and condition Chr 18 pos Variation AA Info Type
rs105752001 A lung neuroendocrine carcinoma sample p.Pro1193Ser
rs1057520015 Likely Pathogenic: Breast neoplasm; Lung carcinoma 20,955,181(-) G/A
NM_005406.3(ROCK1):c.3577C>T (p.Pro1193Ser) 		MISSENSE
rs111381414 Benign: not provided 21,039,464(-) A/G
NM_005406.3(ROCK1):c.1051+8T>C 		INTRON
rs112165707 Benign: not provided 21,006,451(-) A/C
NM_005406.3(ROCK1):c.1785T>G (p.Ser595=) 		SYNONYMOUS
rs45533032 Benign: not provided 20,970,392(-) T/G
NM_005406.3(ROCK1):c.2776A>C (p.Arg926=) 		SYNONYMOUS

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for ROCK1 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for ROCK1 Gene

Variant ID Type Subtype PubMed ID
dgv3324n100 CNV gain 25217958
esv3306568 CNV mobile element insertion 20981092
esv3308855 CNV mobile element insertion 20981092
esv3327515 CNV insertion 20981092
esv3433136 CNV insertion 20981092
esv3437603 CNV insertion 20981092
esv3573920 CNV gain 25503493
esv3641928 CNV gain 21293372
esv3641929 CNV gain 21293372
esv3641931 CNV loss 21293372
nsv833594 CNV gain+loss 17160897
nsv960269 CNV duplication 23825009
nsv960270 CNV duplication 23825009

Variation tolerance for ROCK1 Gene

Residual Variation Intolerance Score: 8.32% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.86; 34.83% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for ROCK1 Gene

Human Gene Mutation Database (HGMD)
ROCK1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
ROCK1
Leiden Open Variation Database (LOVD)
ROCK1

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ROCK1 Gene

Disorders for ROCK1 Gene

MalaCards: The human disease database

(8) MalaCards diseases for ROCK1 Gene - From: CVR, COP, and GCD

Disorder Aliases PubMed IDs
breast cancer
  • breast cancer, familial
pediatric osteosarcoma
  • childhood osteosarcoma
lung cancer
  • lung cancer, susceptibility to
hutchinson-gilford progeria syndrome
  • hgps
ocular hyperemia
  • hyperemia eye
- elite association - COSMIC cancer census association via MalaCards
Search ROCK1 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for ROCK1

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with ROCK1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for ROCK1 Gene

Publications for ROCK1 Gene

  1. ROCK isoform regulation of myosin phosphatase and contractility in vascular smooth muscle cells. (PMID: 19131646) Wang Y ā€¦ Surks HK (Circulation research 2009) 3 4 22
  2. Phosphorylation of profilin by ROCK1 regulates polyglutamine aggregation. (PMID: 18573880) Shao J ā€¦ Diamond MI (Molecular and cellular biology 2008) 3 4 22
  3. Different molecular mechanisms for Rho family GTPase-dependent, Ca2+-independent contraction of smooth muscle. (PMID: 9722579) Van Eyk JE ā€¦ Mak AS (The Journal of biological chemistry 1998) 3 4 22
  4. The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase. (PMID: 8617235) Ishizaki T ā€¦ Narumiya S (The EMBO journal 1996) 2 3 4
  5. Tubulin polymerization promoting protein 1 (Tppp1) phosphorylation by Rho-associated coiled-coil kinase (rock) and cyclin-dependent kinase 1 (Cdk1) inhibits microtubule dynamics to increase cell proliferation. (PMID: 23355470) Schofield AV ā€¦ Bernard O (The Journal of biological chemistry 2013) 3 4

ExternalLinks

View latest publications for ROCK1 gene in Mastermind

Products for ROCK1 Gene

  • Addgene plasmids for ROCK1

Sources for ROCK1 Gene