Free for academic non-profit institutions. Other users need a Commercial license

Aliases for RNF41 Gene

Aliases for RNF41 Gene

  • Ring Finger Protein 41 2 3
  • Ring Finger Protein 41, E3 Ubiquitin Protein Ligase 2 3
  • RING-Type E3 Ubiquitin Transferase NRDP1 3 4
  • RING Finger Protein 41 4 5
  • NRDP1 3 4
  • FLRF 3 4
  • Neuregulin Receptor Degradation Protein-1 3
  • E3 Ubiquitin-Protein Ligase NRDP1 3
  • Fetal Liver Ring Finger 3
  • EC 2.3.2.27 4
  • EC 6.3.2 56
  • SBBI03 3

External Ids for RNF41 Gene

Previous GeneCards Identifiers for RNF41 Gene

  • GC12M056315
  • GC12M054884
  • GC12M056598
  • GC12M053637

Summaries for RNF41 Gene

Entrez Gene Summary for RNF41 Gene

  • This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011]

GeneCards Summary for RNF41 Gene

RNF41 (Ring Finger Protein 41) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include ubiquitin-protein transferase activity and acid-amino acid ligase activity. An important paralog of this gene is RNF151.

UniProtKB/Swiss-Prot for RNF41 Gene

  • Acts as E3 ubiquitin-protein ligase and regulates the degradation of target proteins. Polyubiquitinates MYD88. Negatively regulates MYD88-dependent production of proinflammatory cytokines. Can promote TRIF-dependent production of type I interferon and inhibits infection with vesicular stomatitis virus (By similarity). Promotes also activation of TBK1 and IRF3. Involved in the ubiquitination of erythropoietin (EPO) and interleukin-3 (IL-3) receptors. Thus, through maintaining basal levels of cytokine receptors, RNF41 is involved in the control of hematopoietic progenitor cell differentiation into myeloerythroid lineages (By similarity). Contributes to the maintenance of steady-state ERBB3 levels by mediating its growth factor-independent degradation. Involved in the degradation of the inhibitor of apoptosis BIRC6 and thus is an important regulator of cell death by promoting apoptosis. Acts also as a PRKN modifier that accelerates its degradation, resulting in a reduction of PRKN activity, influencing the balance of intracellular redox state. The RNF41-PRKN pathway regulates autophagosome-lysosome fusion during late mitophagy. Mitophagy is a selective form of autophagy necessary for mitochondrial quality control (PubMed:24949970).

Gene Wiki entry for RNF41 Gene

Additional gene information for RNF41 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RNF41 Gene

Genomics for RNF41 Gene

GeneHancer (GH) Regulatory Elements for RNF41 Gene

Promoters and enhancers for RNF41 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH12I056220 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 550.8 -0.9 -900 5.7 CLOCK MLX ZFP64 FEZF1 DMAP1 YBX1 YY1 SLC30A9 ZNF213 E2F8 NABP2 RNF41 NEMP1 BAZ2A PAN2 DNAJC14 ANKRD52 PHC1P1 ZBTB39 RN7SL809P
GH12I056217 Promoter 0.5 EPDnew 550.8 +4.8 4794 0.1 RNF41 GC12P056196
GH12I056358 Promoter/Enhancer 2.4 EPDnew FANTOM5 Ensembl ENCODE 11.4 -137.9 -137903 3.3 HDGF PKNOX1 SMAD1 ARNT ARID4B NEUROD1 SIN3A DMAP1 ZNF2 IRF4 STAT2 BAZ2A ZC3H10 NEMP1 DNAJC14 ENSG00000257303 ENSG00000258317 IL23A PAN2 RN7SL809P
GH12I056124 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 11 +94.0 93986 6.2 CLOCK MLX FEZF1 DMAP1 IRF4 YY1 SLC30A9 ZNF213 E2F8 ZNF143 ENSG00000258317 ESYT1 BAZ2A NEMP1 RN7SL809P DNAJC14 ZC3H10 SMARCC2 STAT2 PYM1
GH12I056298 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 10.6 -78.8 -78828 4.6 FEZF1 DMAP1 YY1 ZNF213 E2F8 ZNF143 SP3 NFYC ZNF610 GLIS1 ENSG00000257303 CS BAZ2A ZC3H10 NEMP1 RN7SL809P CDK2 DNAJC14 RPL41 MMP19
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around RNF41 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the RNF41 gene promoter:

Genomic Locations for RNF41 Gene

Genomic Locations for RNF41 Gene
chr12:56,202,175-56,221,982
(GRCh38/hg38)
Size:
19,808 bases
Orientation:
Minus strand
chr12:56,596,288-56,615,753
(GRCh37/hg19)

Genomic View for RNF41 Gene

Genes around RNF41 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RNF41 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RNF41 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RNF41 Gene

Proteins for RNF41 Gene

  • Protein details for RNF41 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H4P4-RNF41_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase NRDP1
    Protein Accession:
    Q9H4P4
    Secondary Accessions:
    • A6NFW0
    • B2RBT8
    • O75598

    Protein attributes for RNF41 Gene

    Size:
    317 amino acids
    Molecular mass:
    35905 Da
    Quaternary structure:
    • Interacts with USP8, ERBB3, PRKN and BIRC6. Interacts with CSF2RB, EPOR, IL3RA, MYD88 and TBK1. Interacts with CLEC16A (By similarity).
    SequenceCaution:
    • Sequence=AAG01988.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for RNF41 Gene

    Alternative splice isoforms for RNF41 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RNF41 Gene

Selected DME Specific Peptides for RNF41 Gene

Q9H4P4:
  • AHLRPVPRIMRNMLSKLQI
  • EQKRDIQLLKAYMRAIRS
  • CPICSGVLEEPV
  • EPGLVMIFAHGVEEI
  • IEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRS
  • DCEHNPKRPVTCE
  • PNHNCIKHLRSVVQQQQ
  • GCGLEMPKDE
  • APHCEHAFCNACITQWF
  • NPNLQNLEE
  • WPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACEN

Post-translational modifications for RNF41 Gene

  • Autoubiquitinated. Autoubiquitination leads to proteasomal degradation. Deubiquitinated by USP8 to get stabilized which induces apoptosis.
  • Ubiquitination at isoforms=2174
  • Modification sites at PhosphoSitePlus

Domains & Families for RNF41 Gene

Gene Families for RNF41 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for RNF41 Gene

Suggested Antigen Peptide Sequences for RNF41 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

genes like me logo Genes that share domains with RNF41: view

No data available for UniProtKB/Swiss-Prot for RNF41 Gene

Function for RNF41 Gene

Molecular function for RNF41 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot Function:
Acts as E3 ubiquitin-protein ligase and regulates the degradation of target proteins. Polyubiquitinates MYD88. Negatively regulates MYD88-dependent production of proinflammatory cytokines. Can promote TRIF-dependent production of type I interferon and inhibits infection with vesicular stomatitis virus (By similarity). Promotes also activation of TBK1 and IRF3. Involved in the ubiquitination of erythropoietin (EPO) and interleukin-3 (IL-3) receptors. Thus, through maintaining basal levels of cytokine receptors, RNF41 is involved in the control of hematopoietic progenitor cell differentiation into myeloerythroid lineages (By similarity). Contributes to the maintenance of steady-state ERBB3 levels by mediating its growth factor-independent degradation. Involved in the degradation of the inhibitor of apoptosis BIRC6 and thus is an important regulator of cell death by promoting apoptosis. Acts also as a PRKN modifier that accelerates its degradation, resulting in a reduction of PRKN activity, influencing the balance of intracellular redox state. The RNF41-PRKN pathway regulates autophagosome-lysosome fusion during late mitophagy. Mitophagy is a selective form of autophagy necessary for mitochondrial quality control (PubMed:24949970).

Enzyme Numbers (IUBMB) for RNF41 Gene

Phenotypes From GWAS Catalog for RNF41 Gene

Gene Ontology (GO) - Molecular Function for RNF41 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity TAS --
GO:0005128 erythropoietin receptor binding IEA --
GO:0005135 interleukin-3 receptor binding IEA --
GO:0005515 protein binding IPI 11867753
GO:0008270 zinc ion binding IEA --
genes like me logo Genes that share ontologies with RNF41: view
genes like me logo Genes that share phenotypes with RNF41: view

Animal Model Products

miRNA for RNF41 Gene

miRTarBase miRNAs that target RNF41

Clone Products

  • Addgene plasmids for RNF41

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for RNF41 Gene

Localization for RNF41 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RNF41 gene
Compartment Confidence
cytosol 5
nucleus 4
endoplasmic reticulum 4
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Midbody ring (2)
  • Nuclear bodies (2)
  • Nucleus (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for RNF41 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005829 cytosol TAS --
GO:0048471 perinuclear region of cytoplasm IDA 27353365
GO:0071782 endoplasmic reticulum tubular network IDA 27353365
genes like me logo Genes that share ontologies with RNF41: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for RNF41 Gene

Pathways & Interactions for RNF41 Gene

genes like me logo Genes that share pathways with RNF41: view

UniProtKB/Swiss-Prot Q9H4P4-RNF41_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for RNF41 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination IDA 14765125
GO:0006914 autophagy IEA --
GO:0006915 apoptotic process IEA --
GO:0008285 negative regulation of cell proliferation IDA 17145873
GO:0010468 regulation of gene expression IEA --
genes like me logo Genes that share ontologies with RNF41: view

No data available for SIGNOR curated interactions for RNF41 Gene

Drugs & Compounds for RNF41 Gene

(1) Drugs for RNF41 Gene - From: Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
genes like me logo Genes that share compounds with RNF41: view

Transcripts for RNF41 Gene

Unigene Clusters for RNF41 Gene

Ring finger protein 41:
Representative Sequences:

Clone Products

  • Addgene plasmids for RNF41

Alternative Splicing Database (ASD) splice patterns (SP) for RNF41 Gene

ExUns: 1a · 1b ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5 ^ 6a · 6b · 6c ^ 7a · 7b · 7c ^ 8a · 8b · 8c ^ 9 ^ 10 ^ 11a · 11b
SP1: - -
SP2: - - -
SP3: - - - - - -
SP4: - - - -
SP5: - - - - - - -
SP6: - - -
SP7: - - -
SP8: - -
SP9: - - - - - - -
SP10:

Relevant External Links for RNF41 Gene

GeneLoc Exon Structure for
RNF41
ECgene alternative splicing isoforms for
RNF41

Expression for RNF41 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for RNF41 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for RNF41 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (54.7), Fetal testis (6.1), and Fetal gut (6.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for RNF41 Gene



NURSA nuclear receptor signaling pathways regulating expression of RNF41 Gene:

RNF41

SOURCE GeneReport for Unigene cluster for RNF41 Gene:

Hs.524502

mRNA Expression by UniProt/SwissProt for RNF41 Gene:

Q9H4P4-RNF41_HUMAN
Tissue specificity: Detected in ovary, testis and prostate.

Evidence on tissue expression from TISSUES for RNF41 Gene

  • Blood(4.6)
  • Nervous system(4.2)
  • Muscle(2)
genes like me logo Genes that share expression patterns with RNF41: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for RNF41 Gene

Orthologs for RNF41 Gene

This gene was present in the common ancestor of animals.

Orthologs for RNF41 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia RNF41 33 34
  • 99.89 (n)
dog
(Canis familiaris)
Mammalia RNF41 33 34
  • 95.16 (n)
cow
(Bos Taurus)
Mammalia RNF41 33 34
  • 92.64 (n)
mouse
(Mus musculus)
Mammalia Rnf41 33 16 34
  • 92.22 (n)
rat
(Rattus norvegicus)
Mammalia Rnf41 33
  • 91.47 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia RNF41 34
  • 68 (a)
OneToOne
chicken
(Gallus gallus)
Aves RNF41 34 33
  • 83.81 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia RNF41 34
  • 97 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia rnf41 33
  • 81.91 (n)
Str.4381 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.3157 33
zebrafish
(Danio rerio)
Actinopterygii rnf41 33 34
  • 78.13 (n)
Dr.11667 33
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.721 33
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001882 33
  • 61.06 (n)
fruit fly
(Drosophila melanogaster)
Insecta elgi 33 34
  • 60.85 (n)
Species where no ortholog for RNF41 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • oppossum (Monodelphis domestica)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for RNF41 Gene

ENSEMBL:
Gene Tree for RNF41 (if available)
TreeFam:
Gene Tree for RNF41 (if available)

Paralogs for RNF41 Gene

Paralogs for RNF41 Gene

(2) SIMAP similar genes for RNF41 Gene using alignment to 6 proteins:

genes like me logo Genes that share paralogs with RNF41: view

Variants for RNF41 Gene

Sequence variations from dbSNP and Humsavar for RNF41 Gene

SNP ID Clin Chr 12 pos Variation AA Info Type
rs1000383382 -- 56,218,195(-) C/T genic_upstream_transcript_variant, intron_variant, upstream_transcript_variant
rs1000585678 -- 56,221,599(-) T/C 5_prime_UTR_variant, genic_upstream_transcript_variant, intron_variant
rs1000639034 -- 56,214,829(-) A/T intron_variant
rs1000701340 -- 56,215,252(-) C/T intron_variant
rs1000991781 -- 56,205,862(-) A/G 3_prime_UTR_variant, non_coding_transcript_variant

Structural Variations from Database of Genomic Variants (DGV) for RNF41 Gene

Variant ID Type Subtype PubMed ID
nsv1051961 CNV gain 25217958
nsv482992 CNV gain+loss 15286789
nsv720 CNV insertion 18451855
nsv973989 CNV duplication 23825009

Variation tolerance for RNF41 Gene

Residual Variation Intolerance Score: 32.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.87; 18.12% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for RNF41 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
RNF41

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RNF41 Gene

Disorders for RNF41 Gene

Additional Disease Information for RNF41

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for RNF41 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for RNF41 Gene

Publications for RNF41 Gene

  1. Stabilization of the E3 ubiquitin ligase Nrdp1 by the deubiquitinating enzyme USP8. (PMID: 15314180) Wu X … Carraway KL (Molecular and cellular biology 2004) 3 4 22 58
  2. Genetic screening for mutations in the Nrdp1 gene in Parkinson disease patients in a Chinese population. (PMID: 19800834) Mo X … Xia K (Parkinsonism & related disorders 2010) 3 44 58
  3. Parkin is ubiquitinated by Nrdp1 and abrogates Nrdp1-induced oxidative stress. (PMID: 18541373) Yu F … Zhou J (Neuroscience letters 2008) 3 4 58
  4. Neuregulin-induced ErbB3 downregulation is mediated by a protein stability cascade involving the E3 ubiquitin ligase Nrdp1. (PMID: 17210635) Cao Z … Carraway KL (Molecular and cellular biology 2007) 3 4 58
  5. Structure-based mutagenesis of the substrate-recognition domain of Nrdp1/FLRF identifies the binding site for the receptor tyrosine kinase ErbB3. (PMID: 17384230) Bouyain S … Leahy DJ (Protein science : a publication of the Protein Society 2007) 3 22 58

Products for RNF41 Gene

  • Addgene plasmids for RNF41

Sources for RNF41 Gene

Content
Loading form....