RNF34 Gene (Protein Coding)

Ring Finger Protein 34

GC12P121400
GIFtS:
41
The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-... See more...

Aliases for RNF34 Gene

Aliases for RNF34 Gene

  • Ring Finger Protein 34 2 3 5
  • Human RING Finger Homologous To Inhibitor Of Apoptosis Protein 3 4
  • Ring Finger Protein 34, E3 Ubiquitin Protein Ligase 2 3
  • Caspases-8 And -10-Associated RING Finger Protein 1 3 4
  • RING-Type E3 Ubiquitin Transferase RNF34 3 4
  • E3 Ubiquitin-Protein Ligase RNF34 3 4
  • RING Finger Protein RIFF 3 4
  • Caspase Regulator CARP1 3 4
  • CARP-1 3 4
  • RIFF 2 3
  • HRFI 3 4
  • RIF 2 3
  • FYVE-RING Finger Protein MOMO 3
  • FYVE-RING Finger Protein Momo 4
  • RING Finger Protein 34 4
  • EC 2.3.2.27 4
  • FLJ21786 2
  • EC 6.3.2 51
  • CARP1 3
  • RNF34 5
  • RFI 3

External Ids for RNF34 Gene

Previous GeneCards Identifiers for RNF34 Gene

  • GC12P120717
  • GC12M121524
  • GC12P121621
  • GC12P120250
  • GC12P120251
  • GC12P120300
  • GC12P121837
  • GC12P118847

Summaries for RNF34 Gene

Entrez Gene Summary for RNF34 Gene

  • The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012]

GeneCards Summary for RNF34 Gene

RNF34 (Ring Finger Protein 34) is a Protein Coding gene. Diseases associated with RNF34 include Patellofemoral Pain Syndrome and Duane Retraction Syndrome. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include ligase activity and ubiquitin protein ligase binding. An important paralog of this gene is RFFL.

UniProtKB/Swiss-Prot Summary for RNF34 Gene

  • E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate 'Lys-48'-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through 'Lys-48'-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).

Gene Wiki entry for RNF34 Gene

Additional gene information for RNF34 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for RNF34 Gene

Genomics for RNF34 Gene

GeneHancer (GH) Regulatory Elements Pubs

Download GeneHancer 2017 data
Promoters and enhancers for RNF34 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around RNF34 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for RNF34

Top Transcription factor binding sites by QIAGEN in the RNF34 gene promoter:
  • ARP-1
  • Egr-3
  • GATA-1
  • GATA-2
  • GATA-3
  • HOXA3
  • HOXA5
  • Ik-1
  • RelA
  • S8

Genomic Locations for RNF34 Gene

Latest Assembly
chr12:121,400,041-121,430,623
(GRCh38/hg38)
Size:
30,583 bases
Orientation:
Plus strand

Previous Assembly
chr12:121,837,921-121,862,151
(GRCh37/hg19 by Entrez Gene)
Size:
24,231 bases
Orientation:
Plus strand

chr12:121,837,844-121,868,389
(GRCh37/hg19 by Ensembl)
Size:
30,546 bases
Orientation:
Plus strand

Genomic View for RNF34 Gene

Genes around RNF34 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RNF34 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RNF34 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for RNF34 Gene

Proteins for RNF34 Gene

Products:

  1. Antibodies for research
  2. Protein products for research
  3. Assay products for research

  • Protein details for RNF34 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q969K3-RNF34_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase RNF34
    Protein Accession:
    Q969K3
    Secondary Accessions:
    • B7Z933
    • Q8NG47
    • Q9H6W8

    Protein attributes for RNF34 Gene

    Size:
    372 amino acids
    Molecular mass:
    41641 Da
    Quaternary structure:
    • Interacts with CASP8 and CASP10. Interacts (via RING-type zinc finger) with PPARGC1A. Interacts with NOD1. Interacts with p53/TP53; involved in p53/TP53 ubiquitination. Interacts (via RING-type zinc finger) with MDM2; the interaction stabilizes MDM2.
    SequenceCaution:
    • Sequence=BAH14169.1; Type=Miscellaneous discrepancy; Note=Intron retention.; Evidence={ECO:0000305};

    Alternative splice isoforms for RNF34 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RNF34 Gene

Protein Expression for RNF34 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for RNF34 Gene

Q969K3:
  • SSRSQTSSFFT
  • QENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYL
  • IDCVLLECGHMVTCTKCGKRM
  • RMSECPICR
  • TGPFRFTP
  • GCCEKWEL
  • VRQLKEILARNFVNY

Post-translational modifications for RNF34 Gene

Other Protein References for RNF34 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for RNF34 Gene

Gene Families for RNF34 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for RNF34 Gene

InterPro:
Blocks:
  • Zn-finger, RING
  • DNA-binding SAP
ProtoNet:

Suggested Antigen Peptide Sequences for RNF34 Gene

GenScript: Design optimal peptide antigens:
  • RING finger protein RIFF (RNF34_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q969K3

UniProtKB/Swiss-Prot:

RNF34_HUMAN :
  • The RING-type zinc finger is required for the ubiquitination of target proteins.
Domain:
  • The RING-type zinc finger is required for the ubiquitination of target proteins.
  • The FYVE-type zinc finger domain is required for localization and may confer affinity for cellular compartments enriched in phosphatidylinositol 5-phosphate and phosphatidylinositol 3-phosphate phospholipids.
genes like me logo Genes that share domains with RNF34: view

Function for RNF34 Gene

Products:

  1. Animal Models for research
  2. CRISPR products for research
  3. miRNA products for research
  4. Inhibitory RNAs for research
  5. Clone products for research
  6. Cell Lines for research

Molecular function for RNF34 Gene

UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate 'Lys-48'-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through 'Lys-48'-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27; Evidence={ECO:0000269|PubMed:25012219, ECO:0000269|Ref.13};.

Enzyme Numbers (IUBMB) for RNF34 Gene

Phenotypes From GWAS Catalog for RNF34 Gene

Gene Ontology (GO) - Molecular Function for RNF34 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002039 p53 binding IPI 17121812
GO:0004842 ubiquitin-protein transferase activity IEA --
GO:0005515 protein binding IPI 15069192
GO:0016740 transferase activity IEA --
GO:0031625 ubiquitin protein ligase binding IPI 18382127
genes like me logo Genes that share ontologies with RNF34: view
genes like me logo Genes that share phenotypes with RNF34: view

Animal Models for research

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF34

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for RNF34 Gene

Localization for RNF34 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RNF34 Gene

Cell membrane. Peripheral membrane protein. Endomembrane system. Peripheral membrane protein. Nucleus. Nucleus speckle. Cytoplasm, cytosol.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RNF34 gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 3
extracellular 2
mitochondrion 2
cytoskeleton 1
endosome 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nuclear bodies (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for RNF34 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 22064484
GO:0005654 nucleoplasm IDA,TAS --
GO:0005737 cytoplasm IBA,IDA 15069192
GO:0005829 cytosol IEA --
GO:0005886 plasma membrane IBA,IDA 15069192
genes like me logo Genes that share ontologies with RNF34: view

Pathways & Interactions for RNF34 Gene

genes like me logo Genes that share pathways with RNF34: view

UniProtKB/Swiss-Prot Q969K3-RNF34_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

SIGNOR curated interactions for RNF34 Gene

Inactivates:

Gene Ontology (GO) - Biological Process for RNF34 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006511 ubiquitin-dependent protein catabolic process IEA,IMP 22064484
GO:0006915 apoptotic process IEA --
GO:0016567 protein ubiquitination IEA,IMP 22064484
GO:0035872 nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway IMP 25012219
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process IEA,IMP 22064484
genes like me logo Genes that share ontologies with RNF34: view

Drugs & Compounds for RNF34 Gene

Products:

  1. Drug products for research
No Compound Related Data Available

Transcripts for RNF34 Gene

Products:

  1. CRISPR products for research
  2. miRNA products for research
  3. Inhibitory RNAs for research
  4. Clone products for research

mRNA/cDNA for RNF34 Gene

3 REFSEQ mRNAs :
18 NCBI additional mRNA sequence :
11 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF34

Alternative Splicing Database (ASD) splice patterns (SP) for RNF34 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9 ^ 10a · 10b · 10c
SP1: - - - - -
SP2: - - - - - - - -
SP3: - - - -
SP4: - -
SP5: - - -
SP6:
SP7: - - - - - - - -
SP8: - - -
SP9: - - - - - - - - - - -

Relevant External Links for RNF34 Gene

GeneLoc Exon Structure for
RNF34

Expression for RNF34 Gene

Products:

  1. Primer products for research
  2. Gene Expression Assays for research

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for RNF34 Gene

mRNA expression in normal human tissues for RNF34 Gene
mRNA expression by BioGPS for RNF34 GenemRNA expression by GTEx for RNF34 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for RNF34 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (31.6), Lung (19.5), and Testis (8.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for RNF34 Gene



Protein tissue co-expression partners for RNF34 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for RNF34

SOURCE GeneReport for Unigene cluster for RNF34 Gene:

Hs.292804

mRNA Expression by UniProt/SwissProt for RNF34 Gene:

Q969K3-RNF34_HUMAN
Tissue specificity: Ubiquitous. Detected in heart, brain, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, colon and leukocytes.

Evidence on tissue expression from TISSUES for RNF34 Gene

  • Nervous system(4.9)
  • Kidney(4.4)
  • Muscle(2.1)
  • Intestine(2)
genes like me logo Genes that share expression patterns with RNF34: view

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for RNF34 Gene

Orthologs for RNF34 Gene

This gene was present in the common ancestor of animals.

Orthologs for RNF34 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
 Mammalia RNF34 30 31
  • 99.73 (n)
 OneToOne
Dog
(Canis familiaris)
 Mammalia RNF34 30 31
  • 89.61 (n)
 OneToOne
Cow
(Bos Taurus)
 Mammalia RNF34 30 31
  • 89.07 (n)
 OneToOne
Mouse
(Mus musculus)
 Mammalia Rnf34 30 17 31
  • 86.83 (n)
 OneToOne
Rat
(Rattus norvegicus)
 Mammalia Rnf34 30
  • 86.2 (n)
Platypus
(Ornithorhynchus anatinus)
 Mammalia RNF34 31
  • 82 (a)
 OneToOne
Oppossum
(Monodelphis domestica)
 Mammalia RNF34 31
  • 67 (a)
 OneToOne
Chicken
(Gallus gallus)
 Aves RNF34 30 31
  • 75.51 (n)
 OneToOne
Lizard
(Anolis carolinensis)
 Reptilia -- 31
  • 80 (a)
 OneToMany
-- 31
  • 62 (a)
 OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
 Amphibia rnf34 30
  • 67.62 (n)
Zebrafish
(Danio rerio)
 Actinopterygii rnf34a 30 31
  • 61.74 (n)
 OneToMany
rnf34b 31
  • 57 (a)
 OneToMany
Fruit Fly
(Drosophila melanogaster)
 Insecta CG17019 31 32
  • 17 (a)
 OneToMany
Species where no ortholog for RNF34 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)
  • Worm (Caenorhabditis elegans)

Evolution for RNF34 Gene

ENSEMBL:
Gene Tree for RNF34 (if available)
TreeFam:
Gene Tree for RNF34 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for RNF34: view image

Paralogs for RNF34 Gene

Paralogs for RNF34 Gene

(1) SIMAP similar genes for RNF34 Gene using alignment to 6 proteins:

  • RNF34_HUMAN
  • G3V4D1_HUMAN
  • G3V504_HUMAN
  • G3V566_HUMAN
  • G3V5F1_HUMAN
  • H7BYJ1_HUMAN

Pseudogenes.org Pseudogenes for RNF34 Gene

genes like me logo Genes that share paralogs with RNF34: view

Variants for RNF34 Gene

Products:

  1. SNP Genotyping and Copy Number Assays for research

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for RNF34 Gene

SNP ID Clinical significance and condition Chr 12 pos Variation AA Info Type
rs41507449 Benign: not provided 121,417,808(+) G/A
NM_194271.2(RNF34):c.533G>A (p.Arg178His) 		MISSENSE_VARIANT,INTRON

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for RNF34 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for RNF34 Gene

Variant ID Type Subtype PubMed ID
dgv522e212 CNV loss 25503493

Variation tolerance for RNF34 Gene

Residual Variation Intolerance Score: 16.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.31; 62.93% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for RNF34 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
RNF34

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RNF34 Gene

Disorders for RNF34 Gene

MalaCards: The human disease database

(2) MalaCards diseases for RNF34 Gene - From: COP

Disorder Aliases PubMed IDs
patellofemoral pain syndrome
duane retraction syndrome
  • duane's syndrome
- elite association - COSMIC cancer census association via MalaCards
Search RNF34 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for RNF34

Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with RNF34: view

No data available for UniProtKB/Swiss-Prot and Genatlas for RNF34 Gene

Publications for RNF34 Gene

  1. Isolation and characterization of a novel gene, hRFI, preferentially expressed in esophageal cancer. (PMID: 12118383) Sasaki S … Croce CM (Oncogene 2002) 2 3 4
  2. The E3 ligase RNF34 is a novel negative regulator of the NOD1 pathway. (PMID: 25012219) Zhang R … Liu F (Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2014) 3 4
  3. RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1α and modulates brown fat cell metabolism. (PMID: 22064484) Wei P … Wang YX (Molecular and cellular biology 2012) 3 4
  4. CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2. (PMID: 18382127) Yang W … El-Deiry WS (Cell cycle (Georgetown, Tex.) 2008) 3 4
  5. CARPs are ubiquitin ligases that promote MDM2-independent p53 and phospho-p53ser20 degradation. (PMID: 17121812) Yang W … El-Deiry WS (The Journal of biological chemistry 2007) 3 4

ExternalLinks

View latest publications for RNF34 gene in Mastermind

Products for RNF34 Gene

  • Addgene plasmids for RNF34

Sources for RNF34 Gene