Free for academic non-profit institutions. Other users need a Commercial license
The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-... See more...
Aliases for RNF34 Gene
Aliases for RNF34 Gene
- Ring Finger Protein 34 2 3 5
- Human RING Finger Homologous To Inhibitor Of Apoptosis Protein 3 4
- Ring Finger Protein 34, E3 Ubiquitin Protein Ligase 2 3
- Caspases-8 And -10-Associated RING Finger Protein 1 3 4
- RING-Type E3 Ubiquitin Transferase RNF34 3 4
- E3 Ubiquitin-Protein Ligase RNF34 3 4
- RING Finger Protein RIFF 3 4
- Caspase Regulator CARP1 3 4
- CARP-1 3 4
- RIFF 2 3
External Ids for RNF34 Gene
- HGNC: 17297
- Entrez Gene: 80196
- Ensembl: ENSG00000170633
- OMIM: 608299
- UniProtKB: Q969K3
Previous GeneCards Identifiers for RNF34 Gene
- GC12P120717
- GC12M121524
- GC12P121621
- GC12P120250
- GC12P120251
- GC12P120300
- GC12P121837
- GC12P118847
Summaries for RNF34 Gene
-
The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012]
GeneCards Summary for RNF34 Gene
RNF34 (Ring Finger Protein 34) is a Protein Coding gene. Diseases associated with RNF34 include Adermatoglyphia and Osteogenesis Imperfecta, Type I. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include ligase activity and ubiquitin protein ligase binding. An important paralog of this gene is RFFL.
UniProtKB/Swiss-Prot Summary for RNF34 Gene
-
E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate 'Lys-48'-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through 'Lys-48'-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).
Additional gene information for RNF34 Gene
- HGNC(17297)
- Entrez Gene(80196)
- Ensembl(ENSG00000170633)
- OMIM(608299)
- UniProtKB(Q969K3)
- Open Targets Platform(ENSG00000170633)
- Search for RNF34 at DataMed
- Search for RNF34 at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for RNF34 Gene
Genomics for RNF34 Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for RNF34 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around RNF34 on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for RNF34
- Top Transcription factor binding sites by QIAGEN in the RNF34 gene promoter:
-
- ARP-1
- Egr-3
- GATA-1
- GATA-2
- GATA-3
- HOXA3
- HOXA5
- Ik-1
- RelA
- S8
Genomic Locations for RNF34 Gene
Genomic Locations for RNF34 Gene
- chr12:121,400,041-121,430,623
- (GRCh38/hg38)
- Size:
- 30,583 bases
- Orientation:
- Plus strand
- chr12:121,837,844-121,868,389
- (GRCh37/hg19)
- Size:
- 30,546 bases
- Orientation:
- Plus strand
Genomic View for RNF34 Gene
Genes around RNF34 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 12q24.31 by HGNC
- 12q24.31 by Entrez Gene
- 12q24.31 by Ensembl
RNF34 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for RNF34 Gene
Proteins for RNF34 Gene
-
Protein details for RNF34 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q969K3-RNF34_HUMAN
- Recommended name:
- E3 ubiquitin-protein ligase RNF34
- Protein Accession:
- Q969K3
- B7Z933
- Q8NG47
- Q9H6W8
Protein attributes for RNF34 Gene
- Size:
- 372 amino acids
- Molecular mass:
- 41641 Da
- Quaternary structure:
-
- Interacts with CASP8 and CASP10. Interacts (via RING-type zinc finger) with PPARGC1A. Interacts with NOD1. Interacts with p53/TP53; involved in p53/TP53 ubiquitination. Interacts (via RING-type zinc finger) with MDM2; the interaction stabilizes MDM2.
- SequenceCaution:
-
- Sequence=BAH14169.1; Type=Miscellaneous discrepancy; Note=Intron retention.; Evidence={ECO:0000305};
Protein Expression for RNF34 Gene
Selected DME Specific Peptides for RNF34 Gene
- Q969K3:
-
- SSRSQTSSFFT
- QENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYL
- IDCVLLECGHMVTCTKCGKRM
- RMSECPICR
- TGPFRFTP
- GCCEKWEL
- VRQLKEILARNFVNY
Post-translational modifications for RNF34 Gene
- Autoubiquitinated (in vitro).
- Proteolytically cleaved by caspases upon induction of apoptosis by TNF.
-
Ubiquitination at Lys2
- NX_Q969K3 (NX_Q969K3-1)
- Modification sites at PhosphoSitePlus
Other Protein References for RNF34 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Creative Diagnostics Anti-RNF34 monoclonal antibody
-
Custom Antibody ServicesOriGene Antibodies for RNF34
- Novus Biologicals Antibodies for RNF34
-
Abcam antibodies for RNF34
- Invitrogen Antibodies for RNF34 (AFLGC-RNF34)
-
Biorbyt antibodies for RNF34
-
Boster Bio Antibodies for RNF34
Protein Products
- Search Origene for MassSpec and Protein Over-expression Lysates for RNF34
- Origene Custom Protein Services for RNF34
- ProSpec Recombinant Proteins for RNF34
- antibodies-online: Show 9 available RNF34 Proteins ranked by validation data
- Compare Top RNF34 Proteins
-
Quality Products:
-
Abcam proteins for RNF34
Domains & Families for RNF34 Gene
Gene Families for RNF34 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for RNF34 Gene
- InterPro:
- Blocks:
-
- Zn-finger, RING
- DNA-binding SAP
- ProtoNet:
Suggested Antigen Peptide Sequences for RNF34 Gene
- GenScript: Design optimal peptide antigens:
-
- RING finger protein RIFF (RNF34_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q969K3UniProtKB/Swiss-Prot:
RNF34_HUMAN :- The RING-type zinc finger is required for the ubiquitination of target proteins.
- Domain:
-
- The RING-type zinc finger is required for the ubiquitination of target proteins.
- The FYVE-type zinc finger domain is required for localization and may confer affinity for cellular compartments enriched in phosphatidylinositol 5-phosphate and phosphatidylinositol 3-phosphate phospholipids.
Function for RNF34 Gene
Molecular function for RNF34 Gene
- UniProtKB/Swiss-Prot Function:
- E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate 'Lys-48'-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through 'Lys-48'-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27; Evidence={ECO:0000269|PubMed:25012219, ECO:0000269|Ref.13};.
Enzyme Numbers (IUBMB) for RNF34 Gene
Phenotypes From GWAS Catalog for RNF34 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0002039 | p53 binding | IPI | 17121812 |
| GO:0004842 | ubiquitin-protein transferase activity | IEA | -- |
| GO:0005515 | protein binding | IPI | 15069192 |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0031625 | ubiquitin protein ligase binding | IPI | 18382127 |
Phenotypes for RNF34 Gene
- GenomeRNAi human phenotypes for RNF34:
-
- Increased vaccinia virus (VACV) infection
- no effect
- Increased viability with MLN4924 (a NAE inhibitor)
- shRNA abundance <= 50%
- Increased endosome-nucleus distance (endosomes dispersed in the cell periphery)
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Decreased shRNA abundance (Z-score < -2)
- Increased circadian period length
- Increased shRNA abundance (Z-score > 2)
- Downregulation of NF-kappaB pathway after LMP1 stimulation
- Downregulation of NF-kappaB pathway after IL-1beta stimulation
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for RNF34 - Select products 50% OFF >
- * RNF34 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for RNF34
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for RNF34
-
Santa Cruz Biotechnology (SCBT) CRISPR for RNF34
miRNA for RNF34 Gene
- miRTarBase miRNAs that target RNF34
-
- mmu-miR-425-5p (MIRT008727)
- hsa-miR-181a-5p (MIRT025100)
- hsa-miR-93-5p (MIRT028023)
- hsa-miR-30b-5p (MIRT046149)
- hsa-miR-30c-5p (MIRT047982)
- hsa-miR-619-5p (MIRT693343)
- hsa-miR-7151-3p (MIRT693344)
- hsa-miR-5095 (MIRT693345)
- hsa-miR-6778-3p (MIRT693346)
- hsa-miR-150-5p (MIRT693347)
- hsa-miR-186-3p (MIRT693348)
- hsa-miR-520h (MIRT693349)
- hsa-miR-520g-3p (MIRT693350)
- hsa-miR-6504-3p (MIRT693351)
- hsa-miR-3159 (MIRT693352)
- hsa-miR-520e (MIRT693353)
- hsa-miR-520d-3p (MIRT693354)
- hsa-miR-520c-3p (MIRT693355)
- hsa-miR-520b (MIRT693356)
- hsa-miR-520a-3p (MIRT693357)
- hsa-miR-373-3p (MIRT693358)
- hsa-miR-372-3p (MIRT693359)
- hsa-miR-302e (MIRT693360)
- hsa-miR-302d-3p (MIRT693361)
- hsa-miR-302c-3p (MIRT693362)
- hsa-miR-302b-3p (MIRT693363)
- hsa-miR-302a-3p (MIRT693364)
- hsa-miR-526b-3p (MIRT693365)
- hsa-miR-519d-3p (MIRT693366)
- hsa-miR-20b-5p (MIRT693367)
- hsa-miR-20a-5p (MIRT693368)
- hsa-miR-17-5p (MIRT693369)
- hsa-miR-106b-5p (MIRT693370)
- hsa-miR-106a-5p (MIRT693371)
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for RNF34
- Browse OriGene Inhibitory RNA Products For RNF34
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF34
Clone Products
- Applied Biological Materials (abm): Clones for RNF34 - Select products 50% OFF >
- * RNF34 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG205854
- MR205854
- MR205854L3
- MR205854L4
- RC203191
- RC203191L1
- RC203191L2
- RC203191L3
- RC203191L4
- RC211608
- RC211608L1
- RC211608L2
- RC211608L3
- RC211608L4
- RC233377
- RG203191
- RG211608
- RG233377
- RR201332
- RR201332L3
- RR201332L4
- MR205854L3V
- MR205854L4V
- RC203191L1V
- RC203191L2V
- RC203191L3V
- RC203191L4V
- RC211608L1V
- RC211608L2V
- RC211608L3V
- RC211608L4V
- RR201332L3V
- RR201332L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for RNF34
- Addgene plasmids for RNF34
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for RNF34
Cell Line Products
-
Horizon Cell Lines for RNF34
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for RNF34 Gene
Localization for RNF34 Gene
Subcellular locations from UniProtKB/Swiss-Prot for RNF34 Gene
- Cell membrane. Peripheral membrane protein. Endomembrane system. Peripheral membrane protein. Nucleus. Nucleus speckle. Cytoplasm, cytosol.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| nucleus | 5 |
| cytosol | 4 |
| extracellular | 3 |
| mitochondrion | 2 |
| cytoskeleton | 1 |
| endoplasmic reticulum | 1 |
| endosome | 1 |
| lysosome | 1 |
| golgi apparatus | 1 |
- Nuclear bodies (3)
- Nucleoplasm (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IEA,IDA | 22064484 |
| GO:0005654 | nucleoplasm | IDA,TAS | -- |
| GO:0005737 | cytoplasm | IEA,IDA | 15069192 |
| GO:0005829 | cytosol | IEA | -- |
| GO:0005886 | plasma membrane | IEA,IDA | 15069192 |
Pathways & Interactions for RNF34 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Class I MHC mediated antigen processing and presentation | ||
| 2 | Gene Expression |
.48
|
|
| 3 | Regulation of TP53 Activity | ||
| 4 | Regulation of TP53 Expression and Degradation | ||
| 5 | Innate Immune System |
.61
|
|
Pathways by source for RNF34 Gene
UniProtKB/Swiss-Prot Q969K3-RNF34_HUMAN
- Pathway: Protein modification; protein ubiquitination.
Interacting Proteins for RNF34 Gene
Selected Interacting proteins:
Q969K3-RNF34_HUMAN
ENSP00000376258
for RNF34 Gene via
UniProtKB
STRING
IID
GPS-Prot Interaction Network for RNF34
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006511 | ubiquitin-dependent protein catabolic process | IEA,IMP | 22064484 |
| GO:0006915 | apoptotic process | IEA | -- |
| GO:0016567 | protein ubiquitination | IMP | 22064484 |
| GO:0035872 | nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway | IMP | 25012219 |
| GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process | IEA,IMP | 22064484 |
Transcripts for RNF34 Gene
mRNA/cDNA for RNF34 Gene
- 3 REFSEQ mRNAs :
- 18 NCBI additional mRNA sequence :
- 11 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000361234 2066 nts (view in UCSC)
- ENST00000392464 1722 nts (view in UCSC)
- ENST00000392465 2051 nts (view in UCSC)
- ENST00000553407 1612 nts (view in UCSC)
- ENST00000554484 1603 nts (view in UCSC)
CRISPR Products
- Applied Biological Materials (abm): CRISPR Clones for RNF34 - Select products 50% OFF >
- * RNF34 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
OriGene CRISPR knockouts for RNF34
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for RNF34
-
Santa Cruz Biotechnology (SCBT) CRISPR for RNF34
miRNA Products
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for RNF34
- Browse OriGene Inhibitory RNA Products For RNF34
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF34
Clone Products
- Applied Biological Materials (abm): Clones for RNF34 - Select products 50% OFF >
- * RNF34 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * Gene synthesis, site-directed mutagenesis, subcloning, and more services - Browse All
-
- MG205854
- MR205854
- MR205854L3
- MR205854L4
- RC203191
- RC203191L1
- RC203191L2
- RC203191L3
- RC203191L4
- RC211608
- RC211608L1
- RC211608L2
- RC211608L3
- RC211608L4
- RC233377
- RG203191
- RG211608
- RG233377
- RR201332
- RR201332L3
- RR201332L4
- MR205854L3V
- MR205854L4V
- RC203191L1V
- RC203191L2V
- RC203191L3V
- RC203191L4V
- RC211608L1V
- RC211608L2V
- RC211608L3V
- RC211608L4V
- RR201332L3V
- RR201332L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for RNF34
- Addgene plasmids for RNF34
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for RNF34
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5a | · | 5b | ^ | 6a | · | 6b | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10a | · | 10b | · | 10c |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | ||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||
| SP3: | - | - | - | - | |||||||||||||||||||||||||||||||
| SP4: | - | - | |||||||||||||||||||||||||||||||||
| SP5: | - | - | - | ||||||||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||
| SP8: | - | - | - | ||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | - | - |
Relevant External Links for RNF34 Gene
- GeneLoc Exon Structure for
- RNF34
Expression for RNF34 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Larynx (Respiratory System)
This gene is overexpressed in Peripheral blood mononuclear cells (31.6), Lung (19.5), and Testis (8.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for RNF34 Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for RNF34
SOURCE GeneReport for Unigene cluster for RNF34 Gene:
Hs.292804mRNA Expression by UniProt/SwissProt for RNF34 Gene:
Q969K3-RNF34_HUMAN
Tissue specificity:
Ubiquitous. Detected in heart, brain, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, colon and leukocytes.
Evidence on tissue expression from TISSUES for RNF34 Gene
- Nervous system(4.9)
- Kidney(4.5)
- Muscle(2.7)
- Skin(2.6)
- Intestine(2.5)
- Liver(2.4)
- Spleen(2.4)
- Heart(2.3)
- Blood(2.3)
- Stomach(2.2)
- Lymph node(2.1)
Primer Products
-
OriGene qPCR primer pairs for RNF34
-
OriGene qPCR primer pairs and template standards for RNF34
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for RNF34 Gene
Orthologs for RNF34 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | RNF34 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | RNF34 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | RNF34 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Rnf34 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Rnf34 30 |
|
||
| Platypus (Ornithorhynchus anatinus) |
Mammalia | RNF34 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | RNF34 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | RNF34 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | -- 31 |
|
OneToMany | |
| -- 31 |
|
OneToMany | |||
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | rnf34 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | rnf34a 30 31 |
|
OneToMany | |
| rnf34b 31 |
|
OneToMany | |||
| Fruit Fly (Drosophila melanogaster) |
Insecta | CG17019 31 32 |
|
OneToMany |
- Species where no ortholog for RNF34 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Baker's yeast (Saccharomyces cerevisiae)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rainbow Trout (Oncorhynchus mykiss)
- Rice (Oryza sativa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Squirt (Ciona savignyi)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Thale Cress (Arabidopsis thaliana)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
- Worm (Caenorhabditis elegans)
Evolution for RNF34 Gene
- ENSEMBL:
- Gene Tree for RNF34 (if available)
- TreeFam:
- Gene Tree for RNF34 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for RNF34: view image
Paralogs for RNF34 Gene
Paralogs for RNF34 Gene
(1) SIMAP similar genes for RNF34 Gene using alignment to 6 proteins:
- RNF34_HUMAN
- G3V4D1_HUMAN
- G3V504_HUMAN
- G3V566_HUMAN
- G3V5F1_HUMAN
- H7BYJ1_HUMAN
Pseudogenes.org Pseudogenes for RNF34 Gene
Variants for RNF34 Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for RNF34 Gene
| SNP ID | Clinical significance and condition | Chr 12 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| 778448 | Benign: not provided | 121,417,808(+) | G/A | MISSENSE_VARIANT,INTRON_VARIANT |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv522e212 | CNV | loss | 25503493 |
Residual Variation Intolerance Score:
16.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
4.31;
62.93% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for RNF34 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- RNF34
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RNF34 Gene
Disorders for RNF34 Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| adermatoglyphia |
|
|
| osteogenesis imperfecta, type i |
|
|
Search RNF34 in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for RNF34
No data available for UniProtKB/Swiss-Prot and Genatlas for RNF34 Gene
Publications for RNF34 Gene
- Isolation and characterization of a novel gene, hRFI, preferentially expressed in esophageal cancer. (PMID: 12118383) Sasaki S … Croce CM (Oncogene 2002) 2 3 4
- The E3 ligase RNF34 is a novel negative regulator of the NOD1 pathway. (PMID: 25012219) Zhang R … Liu F (Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2014) 3 4
- RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1α and modulates brown fat cell metabolism. (PMID: 22064484) Wei P … Wang YX (Molecular and cellular biology 2012) 3 4
- CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2. (PMID: 18382127) Yang W … El-Deiry WS (Cell cycle (Georgetown, Tex.) 2008) 3 4
- CARPs are ubiquitin ligases that promote MDM2-independent p53 and phospho-p53ser20 degradation. (PMID: 17121812) Yang W … El-Deiry WS (The Journal of biological chemistry 2007) 3 4
ExternalLinks
Products for RNF34 Gene
- Custom Antibody ServicesOriGene Antibodies for RNF34
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for RNF34
- Origene Custom Protein Services for RNF34
- Origene shrna, sirna, and RNAi products in human, mouse, rat for RNF34
- Browse OriGene Inhibitory RNA Products For RNF34
- OriGene qPCR primer pairs for RNF34
- OriGene qPCR primer pairs and template standards for RNF34
- OriGene CRISPR knockouts for RNF34
- MG205854
- MR205854
- MR205854L3
- MR205854L4
- RC203191
- RC203191L1
- RC203191L2
- RC203191L3
- RC203191L4
- RC211608
- RC211608L1
- RC211608L2
- RC211608L3
- RC211608L4
- RC233377
- RG203191
- RG211608
- RG233377
- RR201332
- RR201332L3
- RR201332L4
- MR205854L3V
- MR205854L4V
- RC203191L1V
- RC203191L2V
- RC203191L3V
- RC203191L4V
- RC211608L1V
- RC211608L2V
- RC211608L3V
- RC211608L4V
- RR201332L3V
- RR201332L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For RNF34
- Sino Biological Human cDNA Clone for RNF34
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for RNF34
- Novus Biologicals proteins and lysates for RNF34
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for RNF34
- Abcam proteins for RNF34
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- VectorBuilder Custom and pre-made DNA vectors for RNF34 (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for RNF34 (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for RNF34 (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for RNF34 CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for RNF34
- Addgene plasmids for RNF34
- antibodies-online: Show 23 available RNF34 Antibodies ranked by validation data
- Compare Top RNF34 Antibodies
- Quality Products:
- antibodies-online: Search results for available RNF34 related products ranked by validation data
- antibodies-online: Show 9 available RNF34 Proteins ranked by validation data
- Compare Top RNF34 Proteins
- Quality Products:
- Horizon Cell Lines for RNF34
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for RNF34
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for RNF34
- Search GeneCopoeia for miRNA 3'UTR Target clone products for RNF34
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF34
- Boster Bio Antibodies for RNF34
- Browse Boster Bio ELISA Kits
- Biorbyt antibodies for RNF34
Sources for RNF34 Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) Genetics Home Reference
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNACentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Signalway Antibody
- (175) Open Targets Platform
- (176) 5SRRNADB
- (177) snoDB
- (178) MirGeneDB