Aliases for RNF34 Gene
Aliases for RNF34 Gene
- Ring Finger Protein 34 2 3
- Human RING Finger Homologous To Inhibitor Of Apoptosis Protein 3 4
- Ring Finger Protein 34, E3 Ubiquitin Protein Ligase 2 3
- Caspases-8 And -10-Associated RING Finger Protein 1 3 4
- RING-Type E3 Ubiquitin Transferase RNF34 3 4
- RING Finger Protein RIFF 3 4
- Caspase Regulator CARP1 3 4
- RING Finger Protein 34 4 5
- CARP-1 3 4
- HRFI 3 4
External Ids for RNF34 Gene
- HGNC: 17297
- Entrez Gene: 80196
- Ensembl: ENSG00000170633
- OMIM: 608299
- UniProtKB: Q969K3
Previous GeneCards Identifiers for RNF34 Gene
- GC12P120717
- GC12M121524
- GC12P121621
- GC12P120250
- GC12P120251
- GC12P120300
- GC12P121837
- GC12P118847
Summaries for RNF34 Gene
-
The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012]
GeneCards Summary for RNF34 Gene
RNF34 (Ring Finger Protein 34) is a Protein Coding gene. Among its related pathways are Innate Immune System and Gene Expression. Gene Ontology (GO) annotations related to this gene include ligase activity and ubiquitin protein ligase binding. An important paralog of this gene is RFFL.
UniProtKB/Swiss-Prot for RNF34 Gene
-
E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate Lys-48-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through Lys-48-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RNF34 Gene
Genomics for RNF34 Gene
GeneHancer (GH) Regulatory Elements for RNF34 Gene
Promoters and enhancers for RNF34 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around RNF34 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for RNF34 Gene
Genomic Locations for RNF34 Gene
- chr12:121,400,041-121,430,623
- (GRCh38/hg38)
- Size:
- 30,583 bases
- Orientation:
- Plus strand
- chr12:121,837,844-121,868,389
- (GRCh37/hg19)
Genomic View for RNF34 Gene
Genes around RNF34 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 12q24.31 by Ensembl
- 12q24.31 by Entrez Gene
- 12q24.31 by HGNC
RNF34 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for RNF34 Gene
Proteins for RNF34 Gene
-
Protein details for RNF34 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q969K3-RNF34_HUMAN
- Recommended name:
- E3 ubiquitin-protein ligase RNF34
- Protein Accession:
- Q969K3
- B7Z933
- Q8NG47
- Q9H6W8
Protein attributes for RNF34 Gene
- Size:
- 372 amino acids
- Molecular mass:
- 41641 Da
- Quaternary structure:
-
- Interacts with CASP8 and CASP10. Interacts (via RING-type zinc finger) with PPARGC1A. Interacts with NOD1. Interacts with p53/TP53; involved in p53/TP53 ubiquitination. Interacts (via RING-type zinc finger) with MDM2; the interaction stabilizes MDM2.
- SequenceCaution:
-
- Sequence=BAH14169.1; Type=Miscellaneous discrepancy; Note=Intron retention.; Evidence={ECO:0000305};
Protein Expression for RNF34 Gene
Selected DME Specific Peptides for RNF34 Gene
- Q969K3:
-
- SSRSQTSSFFT
- QENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYL
- IDCVLLECGHMVTCTKCGKRM
- RMSECPICR
- TGPFRFTP
- GCCEKWEL
- VRQLKEILARNFVNY
Post-translational modifications for RNF34 Gene
- Autoubiquitinated (in vitro).
- Proteolytically cleaved by caspases upon induction of apoptosis by TNF.
- Ubiquitination at Lys2
- Modification sites at PhosphoSitePlus
Other Protein References for RNF34 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
-
Custom Antibody ServicesOriGene Antibodies for RNF34
- Novus Biologicals Antibodies for RNF34
-
Abcam antibodies for RNF34
- Invitrogen Antibodies for RNF34
- Search GeneTex for Antibodies for RNF34
Protein Products
- Search Origene for MassSpec and Protein Over-expression Lysates for RNF34
- Origene Custom Protein Services for RNF34
- ProSpec Recombinant Proteins for RNF34
- Search GeneTex for Proteins for RNF34
-
Abcam proteins for RNF34
Assay Products
Domains & Families for RNF34 Gene
Gene Families for RNF34 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted secreted proteins
Protein Domains for RNF34 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for RNF34 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q969K3UniProtKB/Swiss-Prot:
RNF34_HUMAN :- The RING-type zinc finger is required for the ubiquitination of target proteins.
- Domain:
-
- The RING-type zinc finger is required for the ubiquitination of target proteins.
- The FYVE-type zinc finger domain is required for localization and may confer affinity for cellular compartments enriched in phosphatidylinositol 5-phosphate and phosphatidylinositol 3-phosphate phospholipids.
Function for RNF34 Gene
Molecular function for RNF34 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
- UniProtKB/Swiss-Prot Function:
- E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate Lys-48-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through Lys-48-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).
Enzyme Numbers (IUBMB) for RNF34 Gene
Phenotypes From GWAS Catalog for RNF34 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0002039 | p53 binding | IPI | 17121812 |
| GO:0004842 | ubiquitin-protein transferase activity | IEA | -- |
| GO:0005515 | protein binding | IPI | 15069192 |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0031625 | ubiquitin protein ligase binding | IPI | 18382127 |
Phenotypes for RNF34 Gene
- GenomeRNAi human phenotypes for RNF34:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Increased transferrin (TF) endocytosis
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Downregulation of NF-kappaB pathway after LMP1 stimulation
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased viability with MLN4924 (a NAE inhibitor)
- Increased circadian period length
- Downregulation of NF-kappaB pathway after TNFalpha stimulation
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for RNF34
-
-
ViGene Biosciences lentiviral particle packaged cDNA for RNF34 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for RNF34 gene
- Search ViGene Biosciences for RNF34
CRISPR Products
-
OriGene CRISPR knockouts for RNF34
- genomics-online: gRNA clones - Search results for available RNF34 gene related products
- Applied Biological Materials CRISPR for RNF34
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for RNF34
- GenScript: Design CRISPR guide RNA sequences for RNF34
miRNA for RNF34 Gene
- miRTarBase miRNAs that target RNF34
-
- hsa-mir-181a-5p (MIRT025100)
- hsa-mir-93-5p (MIRT028023)
- hsa-mir-30b-5p (MIRT046149)
- hsa-mir-30c-5p (MIRT047982)
- hsa-mir-619-5p (MIRT693343)
- hsa-mir-7151-3p (MIRT693344)
- hsa-mir-5095 (MIRT693345)
- hsa-mir-6778-3p (MIRT693346)
- hsa-mir-150-5p (MIRT693347)
- hsa-mir-186-3p (MIRT693348)
- hsa-mir-520h (MIRT693349)
- hsa-mir-520g-3p (MIRT693350)
- hsa-mir-6504-3p (MIRT693351)
- hsa-mir-3159 (MIRT693352)
- hsa-mir-520e (MIRT693353)
- hsa-mir-520d-3p (MIRT693354)
- hsa-mir-520c-3p (MIRT693355)
- hsa-mir-520b (MIRT693356)
- hsa-mir-520a-3p (MIRT693357)
- hsa-mir-373-3p (MIRT693358)
- hsa-mir-372-3p (MIRT693359)
- hsa-mir-302e (MIRT693360)
- hsa-mir-302d-3p (MIRT693361)
- hsa-mir-302c-3p (MIRT693362)
- hsa-mir-302b-3p (MIRT693363)
- hsa-mir-302a-3p (MIRT693364)
- hsa-mir-526b-3p (MIRT693365)
- hsa-mir-519d-3p (MIRT693366)
- hsa-mir-20b-5p (MIRT693367)
- hsa-mir-20a-5p (MIRT693368)
- hsa-mir-17-5p (MIRT693369)
- hsa-mir-106b-5p (MIRT693370)
- hsa-mir-106a-5p (MIRT693371)
miRNA Products
- Search ViGene Biosciences for RNF34
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for RNF34
- Browse OriGene Inhibitory RNA Products For RNF34
- genomics-online: shRNA clones - Search results for available RNF34 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for RNF34 gene
Clone Products
- Sino Biological Human cDNA Clone for RNF34
- VectorBuilder custom plasmid, inducible vectors for RNF34
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for RNF34
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for RNF34
- genomics-online: cdna clones - Search results for available RNF34 gene related products
- orf clones - Search results for available RNF34 gene related products
- Applied Biological Materials Clones for RNF34
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for RNF34
-
ViGene Biosciences adenoviral particle packaged cDNA for RNF34 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for RNF34 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for RNF34 gene
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for RNF34 Gene
Localization for RNF34 Gene
Subcellular locations from UniProtKB/Swiss-Prot for RNF34 Gene
- Cell membrane; Peripheral membrane protein. Endomembrane system; Peripheral membrane protein. Nucleus. Nucleus speckle. Cytoplasm, cytosol.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| nucleus | 5 |
| cytosol | 4 |
| extracellular | 2 |
| mitochondrion | 1 |
- Nuclear bodies (3)
- Nucleoplasm (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IDA,IEA | 22064484 |
| GO:0005654 | nucleoplasm | IDA,TAS | -- |
| GO:0005737 | cytoplasm | IEA,IDA | 15069192 |
| GO:0005829 | cytosol | IEA | -- |
| GO:0005886 | plasma membrane | IDA,IEA | 15069192 |
Pathways & Interactions for RNF34 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Class I MHC mediated antigen processing and presentation | ||
| 2 | Gene Expression |
.48
|
|
| 3 | Regulation of TP53 Activity | ||
| 4 | Regulation of TP53 Expression and Degradation | ||
| 5 | Innate Immune System |
.61
|
|
Pathways by source for RNF34 Gene
UniProtKB/Swiss-Prot Q969K3-RNF34_HUMAN
- Pathway: Protein modification; protein ubiquitination.
Interacting Proteins for RNF34 Gene
Selected Interacting proteins:
Q969K3-RNF34_HUMAN
ENSP00000376258
for RNF34 Gene via
IID
STRING
UniProtKB
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006915 | apoptotic process | IEA | -- |
| GO:0016567 | protein ubiquitination | IMP | 22064484 |
| GO:0035872 | nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway | IMP | 25012219 |
| GO:0042787 | protein ubiquitination involved in ubiquitin-dependent protein catabolic process | IEA,IMP | 22064484 |
| GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process | IEA,IMP | 22064484 |
No data available for SIGNOR curated interactions for RNF34 Gene
Transcripts for RNF34 Gene
mRNA/cDNA for RNF34 Gene
- (3) REFSEQ mRNAs :
- (10) Additional mRNA sequences :
- (259) Selected AceView cDNA sequences:
- (11) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for RNF34 Gene
CRISPR Products
-
OriGene CRISPR knockouts for RNF34
- genomics-online: gRNA clones - Search results for available RNF34 gene related products
- Applied Biological Materials CRISPR for RNF34
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for RNF34
- GenScript: Design CRISPR guide RNA sequences for RNF34
miRNA Products
- Search ViGene Biosciences for RNF34
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for RNF34
- Browse OriGene Inhibitory RNA Products For RNF34
- genomics-online: shRNA clones - Search results for available RNF34 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for RNF34 gene
Clone Products
- Sino Biological Human cDNA Clone for RNF34
- VectorBuilder custom plasmid, inducible vectors for RNF34
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for RNF34
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for RNF34
- genomics-online: cdna clones - Search results for available RNF34 gene related products
- orf clones - Search results for available RNF34 gene related products
- Applied Biological Materials Clones for RNF34
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | ^ | 2 | ^ | 3 | ^ | 4 | ^ | 5a | · | 5b | ^ | 6a | · | 6b | ^ | 7 | ^ | 8a | · | 8b | ^ | 9 | ^ | 10a | · | 10b | · | 10c |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | - | ||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||
| SP3: | - | - | - | - | |||||||||||||||||||||||||||||||
| SP4: | - | - | |||||||||||||||||||||||||||||||||
| SP5: | - | - | - | ||||||||||||||||||||||||||||||||
| SP6: | |||||||||||||||||||||||||||||||||||
| SP7: | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||
| SP8: | - | - | - | ||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | - | - |
Expression for RNF34 Gene
This gene is overexpressed in Peripheral blood mononuclear cells (31.6), Lung (19.5), and Testis (8.8).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for RNF34 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of RNF34 Gene:
RNF34SOURCE GeneReport for Unigene cluster for RNF34 Gene:
Hs.292804mRNA Expression by UniProt/SwissProt for RNF34 Gene:
Q969K3-RNF34_HUMAN
Tissue specificity:
Ubiquitous. Detected in heart, brain, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, colon and leukocytes.
Evidence on tissue expression from TISSUES for RNF34 Gene
- Nervous system(4.8)
- Kidney(4.4)
- Intestine(2.3)
- Muscle(2.1)
Primer Products
-
OriGene qPCR primer pairs for RNF34
-
OriGene qPCR primer pairs and template standards for RNF34
- genomics-online: primer clones - Search results for available RNF34 gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for RNF34 Gene
Orthologs for RNF34 Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | RNF34 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | RNF34 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | RNF34 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Rnf34 33 16 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Rnf34 33 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | RNF34 34 |
|
OneToOne | |
| oppossum (Monodelphis domestica) |
Mammalia | RNF34 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | RNF34 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | -- 34 |
|
OneToMany | |
| -- 34 |
|
OneToMany | |||
| tropical clawed frog (Silurana tropicalis) |
Amphibia | rnf34 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | rnf34a 33 34 |
|
||
| rnf34b 34 |
|
OneToMany | |||
| fruit fly (Drosophila melanogaster) |
Insecta | CG17019 35 34 |
|
- Species where no ortholog for RNF34 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for RNF34 Gene
Paralogs for RNF34 Gene
(1) SIMAP similar genes for RNF34 Gene using alignment to 6 proteins:
Pseudogenes.org Pseudogenes for RNF34 Gene
Variants for RNF34 Gene
| SNP ID | Clin | Chr 12 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1000505227 | -- | 121,410,175(+) | A/G | intron_variant | |
| rs1000790500 | -- | 121,398,145(+) | G/A | upstream_transcript_variant | |
| rs1000932822 | -- | 121,423,222(+) | G/A | intron_variant | |
| rs1001137130 | -- | 121,403,823(+) | T/C | intron_variant | |
| rs1001171898 | -- | 121,407,086(+) | C/G | intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv522e212 | CNV | loss | 25503493 |
Residual Variation Intolerance Score:
16.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
4.31;
62.93% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for RNF34 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- RNF34
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RNF34 Gene
Disorders for RNF34 Gene
Additional Disease Information for RNF34
No disorders were found for RNF34 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for RNF34 Gene
Publications for RNF34 Gene
- Isolation and characterization of a novel gene, hRFI, preferentially expressed in esophageal cancer. (PMID: 12118383) Sasaki S … Croce CM (Oncogene 2002) 2 3 4 58
- The E3 ligase RNF34 is a novel negative regulator of the NOD1 pathway. (PMID: 25012219) Zhang R … Liu F (Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology 2014) 3 4 58
- RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1α and modulates brown fat cell metabolism. (PMID: 22064484) Wei P … Wang YX (Molecular and cellular biology 2012) 3 4 58
- CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2. (PMID: 18382127) Yang W … El-Deiry WS (Cell cycle (Georgetown, Tex.) 2008) 3 4 58
- CARPs are ubiquitin ligases that promote MDM2-independent p53 and phospho-p53ser20 degradation. (PMID: 17121812) Yang W … El-Deiry WS (The Journal of biological chemistry 2007) 3 4 58
Products for RNF34 Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for RNF34
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for RNF34
- Origene Custom Protein Services for RNF34
- Origene shrna, sirna, and RNAi products in human, mouse, rat for RNF34
- Browse OriGene Inhibitory RNA Products For RNF34
- OriGene qPCR primer pairs and template standards for RNF34
- OriGene qPCR primer pairs for RNF34
- OriGene CRISPR knockouts for RNF34
- OriGene ORF clones in human for RNF34
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For RNF34
- GenScript: Next-day shipping of latest version cDNA ORF clones for RNF34 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for RNF34
- GenScript Custom Assay Services for RNF34
- GenScript Custom overexpressing Cell Line Services for RNF34
- GenScript: Design CRISPR guide RNA sequences for RNF34
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for RNF34
- Sino Biological Human cDNA Clone for RNF34
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for RNF34
- Novus Biologicals lysates and proteins for RNF34
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for RNF34
- Abcam proteins for RNF34
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for RNF34
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Cyagen custom Knockout/knockin (KOKI) mouse models for RNF34
- VectorBuilder custom plasmid, inducible vectors for RNF34
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for RNF34
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for RNF34
- antibodies-online: Search results for 86 available RNF34 Antibodies ranked by validation data
- Compare Top RNF34 Antibodies
- Quality Products:
- antibodies-online: Search results for available RNF34 related products ranked by validation data
- antibodies-online: Search results for 8 available RNF34 Proteins ranked by validation data
- Compare Top RNF34 Proteins
- Quality Products:
- Search GeneTex for Antibodies for RNF34
- Search GeneTex for Proteins for RNF34
- ViGene Biosciences adenoviral particle packaged cDNA for RNF34 gene
- ViGene Biosciences lentiviral particle packaged cDNA for RNF34 gene
- ViGene Biosciences ready-to-package AAV shRNAs for RNF34 gene
- Search ViGene Biosciences for RNF34
- Horizon Cell Lines for RNF34
- genomics-online: cdna clones - Search results for available RNF34 gene related products
- orf clones - Search results for available RNF34 gene related products
- genomics-online: gRNA clones - Search results for available RNF34 gene related products
- genomics-online: primer clones - Search results for available RNF34 gene related products
- genomics-online: shRNA clones - Search results for available RNF34 gene related products
Sources for RNF34 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems