The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. The protein encoded by this human gene is an E3 ubiquitin ligase that regulates chromosome structure by monoubiquitinating histone H2B. This protein acts as a putative tumor suppressor and positively regulates the p53 tumor suppressor as well as numerous histone H2A and H2B genes. In contrast, this p... See more...

Aliases for RNF20 Gene

Aliases for RNF20 Gene

  • Ring Finger Protein 20 2 3 5
  • RING-Type E3 Ubiquitin Transferase BRE1A 3 4
  • E3 Ubiquitin-Protein Ligase BRE1A 3 4
  • BRE1A 3 4
  • HBRE1 3 4
  • BRE1 E3 Ubiquitin Ligase Homolog (S. Cerevisiae) 2
  • BRE1 E3 Ubiquitin Ligase Homolog 3
  • Homolog Of S. Cerevisiae BRE1 3
  • RING Finger Protein 20 4
  • EC 2.3.2.27 4
  • EC 6.3.2 52
  • BRE1-A 4
  • BRE1 3

External Ids for RNF20 Gene

Previous GeneCards Identifiers for RNF20 Gene

  • GC09P095096
  • GC09P096039
  • GC09P097753
  • GC09P099675
  • GC09P101375
  • GC09P103335
  • GC09P104296
  • GC09P073896

Summaries for RNF20 Gene

Entrez Gene Summary for RNF20 Gene

  • The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. The protein encoded by this human gene is an E3 ubiquitin ligase that regulates chromosome structure by monoubiquitinating histone H2B. This protein acts as a putative tumor suppressor and positively regulates the p53 tumor suppressor as well as numerous histone H2A and H2B genes. In contrast, this protein also suppresses the expression of several protooncogenes and growth-related genes, including many genes that are induced by epidermal growth factor. This gene selectively suppresses the expression of some genes by interfering with chromatin recruitment of transcription elongation factor SII (TFIIS). [provided by RefSeq, Feb 2012]

GeneCards Summary for RNF20 Gene

RNF20 (Ring Finger Protein 20) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Protein ubiquitination. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and ligase activity. An important paralog of this gene is RNF40.

UniProtKB/Swiss-Prot Summary for RNF20 Gene

  • Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role inb histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Recruited to the MDM2 promoter, probably by being recruited by p53/TP53, and thereby acts as a transcriptional coactivator. Mediates the polyubiquitination of isoform 2 of PA2G4 in cancer cells leading to its proteasome-mediated degradation.

Gene Wiki entry for RNF20 Gene

Additional gene information for RNF20 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for RNF20 Gene

Genomics for RNF20 Gene

GeneHancer (GH) Regulatory Elements for RNF20 Gene

Promoters and enhancers for RNF20 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH09J101532 Promoter/Enhancer 2 EPDnew Ensembl ENCODE CraniofacialAtlas 500.7 +0.1 52 2.2 ZBTB40 ZNF217 EP300 NRF1 POLR2G SP1 PHF8 SIX5 ZFX POLR2A PGAP4 RNF20 lnc-TMEM246-1 TMEM246-AS1 piR-57134-113
GH09J101469 Promoter/Enhancer 0.5 EPDnew Ensembl 500.2 -64.4 -64359 0.2 TMEM246-AS1 RNF20 lnc-TMEM246-2
GH09J101430 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 11.4 -92.5 -92461 20.9 EP300 HNRNPK ZNF217 CTCF POLR2G NCOR1 KDM6A TCF7 ZBTB26 TARDBP ALDOB LOC105376184 ZNF189 PGAP4 RNF20 MRPL50 TMEM246-AS1 BAAT ENSG00000270982 piR-60146-194
GH09J101485 Promoter/Enhancer 2.1 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas 6.1 -46.9 -46881 3.1 CTCF NRF1 USF1 ZIC2 POLR2A ZBTB10 ZBTB26 ZNF510 KLF7 MYC PGAP4 TMEM246-AS1 RNF20 lnc-ALDOB-1 lnc-TMEM246-2 ENSG00000233055
GH09J101459 Enhancer 0.9 Ensembl ENCODE 12.1 -74.8 -74848 1.2 CTCF REST TGIF2 RAD21 TRIM22 ZBTB26 SMC3 SAP130 ZNF205 ELF1 RF00017-7776 PGAP4 RNF20 TMEM246-AS1 LOC105376184
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around RNF20 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for RNF20

Top Transcription factor binding sites by QIAGEN in the RNF20 gene promoter:
  • aMEF-2
  • AML1a
  • CBF(2)
  • En-1
  • MEF-2
  • MEF-2A
  • NF-Y
  • Nkx6-1
  • Pax-2
  • Pax-2a

Genomic Locations for RNF20 Gene

Genomic Locations for RNF20 Gene
chr9:101,533,849-101,563,344
(GRCh38/hg38)
Size:
29,496 bases
Orientation:
Plus strand
chr9:104,296,133-104,325,626
(GRCh37/hg19)
Size:
29,494 bases
Orientation:
Plus strand

Genomic View for RNF20 Gene

Genes around RNF20 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RNF20 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RNF20 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RNF20 Gene

Proteins for RNF20 Gene

  • Protein details for RNF20 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q5VTR2-BRE1A_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase BRE1A
    Protein Accession:
    Q5VTR2
    Secondary Accessions:
    • A7MCT5
    • Q2TB34
    • Q69YL5
    • Q6P527
    • Q8N3J4
    • Q96JD3
    • Q9H9Y7
    • Q9HA51
    • Q9NUR4
    • Q9NWQ3
    • Q9NX83

    Protein attributes for RNF20 Gene

    Size:
    975 amino acids
    Molecular mass:
    113662 Da
    Quaternary structure:
    • Component of the RNF20/40 complex (also known as BRE1 complex) probably composed of 2 copies of RNF20/BRE1A and 2 copies of RNF40/BRE1B. Interacts with UBE2E1/UBCH6. Interacts with p53/TP53 and WAC. Interacts with PAF1; the interaction mediates the association of the PAF1 and RNF20/40 complexes which is a prerequsite for recruitment of UBE2A/B. Interacts with isoform 1 and isoform 2 of PA2G4.
    SequenceCaution:
    • Sequence=AAH63115.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305}; Sequence=BAA91326.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305}; Sequence=BAA92057.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305}; Sequence=BAB14005.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for RNF20 Gene

neXtProt entry for RNF20 Gene

Selected DME Specific Peptides for RNF20 Gene

Q5VTR2:
  • AAQLADDLK
  • VLERVNSKGYKVYGAGSSLYGGTITINARKFEEMNAELEE
  • RKKDAVLTKCFHVFCFECV
  • KKLRTEV
  • RDEEERERERRE
  • FGANDFHRI
  • ESQLQERVESSRRAV
  • VTGQAFEDMQEQN
  • VKETPEYRCMQSQFSVLYNESLQLKAHLDEARTLLHGTR
  • IGTGEKELGLRTQALEMNKRKAM
  • IDKIRKREQRLNRHLA
  • EPAFSFLATLASS
  • QLEDTLAQVRKEYEMLRIEFEQ
  • QQLREKDDANFKLMSERIK
  • KVETAESRVSVLE
  • DFHRIYI
  • PINREMRHLI
  • LLIVNRYW
  • ERKALVVPEPEPDSDSNQERKD
  • YKARLTCPCCN
  • EDISRLRRKLE
  • RQRKCPKCN
  • RSGSALLQSQSSTED
  • QFDENIRIILKR
  • QRDKVQLMA

Post-translational modifications for RNF20 Gene

  • Ubiquitination at Lys194, Lys242, and Lys821
  • Modification sites at PhosphoSitePlus

Other Protein References for RNF20 Gene

Domains & Families for RNF20 Gene

Gene Families for RNF20 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for RNF20 Gene

Suggested Antigen Peptide Sequences for RNF20 Gene

GenScript: Design optimal peptide antigens:
  • RNF20 protein (A0PJJ6_HUMAN)
  • RING finger protein 20 (BRE1A_HUMAN)
  • RNF20 protein (Q05DC0_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q5VTR2

UniProtKB/Swiss-Prot:

BRE1A_HUMAN :
  • Belongs to the BRE1 family.
Family:
  • Belongs to the BRE1 family.
genes like me logo Genes that share domains with RNF20: view

Function for RNF20 Gene

Molecular function for RNF20 Gene

UniProtKB/Swiss-Prot Function:
Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role inb histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Recruited to the MDM2 promoter, probably by being recruited by p53/TP53, and thereby acts as a transcriptional coactivator. Mediates the polyubiquitination of isoform 2 of PA2G4 in cancer cells leading to its proteasome-mediated degradation.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27; Evidence={ECO:0000269 PubMed:16307923, ECO:0000269 PubMed:16337599, ECO:0000269 PubMed:19410543};.

Enzyme Numbers (IUBMB) for RNF20 Gene

Phenotypes From GWAS Catalog for RNF20 Gene

Gene Ontology (GO) - Molecular Function for RNF20 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002039 p53 binding IDA 16337599
GO:0003682 chromatin binding IEA --
GO:0003713 transcription coactivator activity IDA 16337599
GO:0003730 mRNA 3'-UTR binding IDA 19575011
GO:0004842 contributes_to ubiquitin-protein transferase activity IDA,IEA 16307923
genes like me logo Genes that share ontologies with RNF20: view
genes like me logo Genes that share phenotypes with RNF20: view

Animal Models for RNF20 Gene

MGI Knock Outs for RNF20:
  • Rnf20 Rnf20<tm1.1(KOMP)Vlcg>

Animal Model Products

  • Taconic Biosciences Mouse Models for RNF20

miRNA for RNF20 Gene

miRTarBase miRNAs that target RNF20

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for RNF20 Gene

Localization for RNF20 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RNF20 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RNF20 gene
Compartment Confidence
nucleus 5
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1
peroxisome 1
endoplasmic reticulum 1
endosome 1
cytosol 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for RNF20 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000151 ubiquitin ligase complex IDA 16307923
GO:0005634 nucleus IDA,IEA 16307923
GO:0005654 nucleoplasm TAS,IDA --
GO:0005730 nucleolus IDA 19037095
GO:0033503 HULC complex IDA 19410543
genes like me logo Genes that share ontologies with RNF20: view

Pathways & Interactions for RNF20 Gene

genes like me logo Genes that share pathways with RNF20: view

Pathways by source for RNF20 Gene

UniProtKB/Swiss-Prot Q5VTR2-BRE1A_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

SIGNOR curated interactions for RNF20 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for RNF20 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination IDA 19037095
GO:0006325 chromatin organization IEA --
GO:0006355 regulation of transcription, DNA-templated IMP 18832071
GO:0006511 ubiquitin-dependent protein catabolic process IMP 19037095
GO:0007346 NOT regulation of mitotic cell cycle IMP 19575011
genes like me logo Genes that share ontologies with RNF20: view

Drugs & Compounds for RNF20 Gene

(3) Drugs for RNF20 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for RNF20 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8
genes like me logo Genes that share compounds with RNF20: view

Transcripts for RNF20 Gene

mRNA/cDNA for RNF20 Gene

1 REFSEQ mRNAs :
19 NCBI additional mRNA sequence :
6 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for RNF20 Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4 ^ 5 ^ 6a · 6b ^ 7a · 7b ^ 8a · 8b · 8c · 8d ^ 9a · 9b · 9c · 9d · 9e ^ 10a · 10b ^ 11a · 11b ^ 12a · 12b ^ 13 ^
SP1:
SP2:
SP3: - - - -
SP4: - - - -
SP5: - - - - -
SP6: - -
SP7:
SP8:
SP9: - - -
SP10: - -
SP11:
SP12: -
SP13:
SP14:

ExUns: 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22a · 22b ^ 23a · 23b ^ 24 ^ 25
SP1: - -
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:

Relevant External Links for RNF20 Gene

GeneLoc Exon Structure for
RNF20

Expression for RNF20 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for RNF20 Gene

Protein differential expression in normal tissues from HIPED for RNF20 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (18.6) and Lymph node (13.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for RNF20 Gene



Protein tissue co-expression partners for RNF20 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for RNF20

SOURCE GeneReport for Unigene cluster for RNF20 Gene:

Hs.729085

mRNA Expression by UniProt/SwissProt for RNF20 Gene:

Q5VTR2-BRE1A_HUMAN
Tissue specificity: Expressed in the normal brain and also in malignant gliomas (at protein level).

Evidence on tissue expression from TISSUES for RNF20 Gene

  • Nervous system(4.7)
  • Liver(4.3)
  • Intestine(4.2)
  • Thyroid gland(4.2)
genes like me logo Genes that share expression patterns with RNF20: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for RNF20 Gene

Orthologs for RNF20 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for RNF20 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia RNF20 31 30
  • 99.69 (n)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia RNF20 31
  • 94 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia RNF20 31
  • 94 (a)
OneToOne
dog
(Canis familiaris)
Mammalia RNF20 31 30
  • 92.79 (n)
OneToOne
cow
(Bos Taurus)
Mammalia RNF20 31 30
  • 92.51 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Rnf20 17 31 30
  • 90.34 (n)
rat
(Rattus norvegicus)
Mammalia Rnf20 30
  • 89 (n)
chicken
(Gallus gallus)
Aves RNF20 31 30
  • 79.77 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia -- 31
  • 97 (a)
OneToMany
-- 31
  • 85 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia rnf20 30
  • 69.32 (n)
Str.444 30
zebrafish
(Danio rerio)
Actinopterygii rnf20 31 30
  • 72.08 (n)
OneToOne
Dr.6244 30
fruit fly
(Drosophila melanogaster)
Insecta CG10542 32
  • 46 (a)
Bre1 31
  • 41 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea R05D3.4 32
  • 26 (a)
rfp-1 31
  • 24 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes BRE1 31
  • 21 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.10524 31
  • 40 (a)
OneToMany
Species where no ortholog for RNF20 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for RNF20 Gene

ENSEMBL:
Gene Tree for RNF20 (if available)
TreeFam:
Gene Tree for RNF20 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for RNF20: view image

Paralogs for RNF20 Gene

Paralogs for RNF20 Gene

(1) SIMAP similar genes for RNF20 Gene using alignment to 6 proteins:

  • BRE1A_HUMAN
  • A0PJJ6_HUMAN
  • C9J0A5_HUMAN
  • C9JWJ4_HUMAN
  • C9JXC9_HUMAN
  • Q05DC0_HUMAN
genes like me logo Genes that share paralogs with RNF20: view

Variants for RNF20 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for RNF20 Gene

SNP ID Clinical significance and condition Chr 09 pos Variation AA Info Type
716921 Likely Benign: not provided 101,561,120(+) C/T MISSENSE_VARIANT
743589 Likely Benign: not provided 101,544,814(+) G/A MISSENSE_VARIANT
750679 Likely Benign: not provided 101,562,237(+) T/C INTRON_VARIANT
780821 Benign: not provided 101,552,733(+) A/G SYNONYMOUS_VARIANT
rs367537997 Not Provided: not provided 101,540,320(+) C/T NONSENSE

Additional dbSNP identifiers (rs#s) for RNF20 Gene

Structural Variations from Database of Genomic Variants (DGV) for RNF20 Gene

Variant ID Type Subtype PubMed ID
esv3310561 CNV novel sequence insertion 20981092
esv3400403 CNV insertion 20981092
esv3545209 CNV deletion 23714750
nsv831672 CNV gain 17160897

Variation tolerance for RNF20 Gene

Residual Variation Intolerance Score: 7.65% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.40; 42.47% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for RNF20 Gene

Human Gene Mutation Database (HGMD)
RNF20
SNPedia medical, phenotypic, and genealogical associations of SNPs for
RNF20

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RNF20 Gene

Disorders for RNF20 Gene

Additional Disease Information for RNF20

No disorders were found for RNF20 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for RNF20 Gene

Publications for RNF20 Gene

  1. Human BRE1 is an E3 ubiquitin ligase for Ebp1 tumor suppressor. (PMID: 19037095) Liu Z … Ye K (Molecular biology of the cell 2009) 2 3 4 54
  2. The histone H2B-specific ubiquitin ligase RNF20/hBRE1 acts as a putative tumor suppressor through selective regulation of gene expression. (PMID: 18832071) Shema E … Oren M (Genes & development 2008) 2 3 23 54
  3. The human homolog of yeast BRE1 functions as a transcriptional coactivator through direct activator interactions. (PMID: 16337599) Kim J … Roeder RG (Molecular cell 2005) 2 3 4 54
  4. WAC, a functional partner of RNF20/40, regulates histone H2B ubiquitination and gene transcription. (PMID: 21329877) Zhang F … Yu X (Molecular cell 2011) 3 4 54
  5. RAD6-Mediated transcription-coupled H2B ubiquitylation directly stimulates H3K4 methylation in human cells. (PMID: 19410543) Kim J … Roeder RG (Cell 2009) 3 4 54

Products for RNF20 Gene

Sources for RNF20 Gene