Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart ... See more...

Aliases for RNF2 Gene

Aliases for RNF2 Gene

  • Ring Finger Protein 2 2 3 5
  • Huntingtin-Interacting Protein 2-Interacting Protein 3 3 4
  • RING-Type E3 Ubiquitin Transferase RING2 3 4
  • E3 Ubiquitin-Protein Ligase RING2 3 4
  • HIP2-Interacting Protein 3 3 4
  • RING Finger Protein BAP-1 3 4
  • RING Finger Protein 1B 3 4
  • Protein DinG 3 4
  • RING1B 3 4
  • HIPI3 3 4
  • BAP1 3 4
  • DING 3 4
  • RING Finger Protein 2 4
  • EC 2.3.2.27 4
  • EC 6.3.2 52
  • RING1b 4
  • BAP-1 3
  • RING2 3

External Ids for RNF2 Gene

Previous GeneCards Identifiers for RNF2 Gene

  • GC01P182540
  • GC01P180442
  • GC01P181534
  • GC01P182253
  • GC01P181746
  • GC01P183281
  • GC01P185014
  • GC01P156249

Summaries for RNF2 Gene

Entrez Gene Summary for RNF2 Gene

  • Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq, Jul 2008]

GeneCards Summary for RNF2 Gene

RNF2 (Ring Finger Protein 2) is a Protein Coding gene. Diseases associated with RNF2 include Angelman Syndrome and Trichothiodystrophy 1, Photosensitive. Among its related pathways are Metabolism of proteins and SUMOylation. Gene Ontology (GO) annotations related to this gene include chromatin binding and ubiquitin-protein transferase activity. An important paralog of this gene is RING1.

UniProtKB/Swiss-Prot Summary for RNF2 Gene

  • E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation (PubMed:15386022, PubMed:16359901, PubMed:25519132, PubMed:21772249, PubMed:25355358, PubMed:26151332). H2AK119Ub gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation (By similarity). Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed:16359901, PubMed:26151332). PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility (PubMed:26151332). E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4 (PubMed:21772249). Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity (Probable). Association with the chromosomal DNA is cell-cycle dependent. In resting B- and T-lymphocytes, interaction with AURKB leads to block its activity, thereby maintaining transcription in resting lymphocytes (By similarity).

Gene Wiki entry for RNF2 Gene

Additional gene information for RNF2 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for RNF2 Gene

Genomics for RNF2 Gene

GeneHancer (GH) Regulatory Elements for RNF2 Gene

Promoters and enhancers for RNF2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01J185043 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 500.7 +0.3 298 4.2 HNRNPK EP300 SIN3A MYC NRF1 POLR2G NCOR1 PHF8 TEAD4 ZFX RNF2 SWT1 NIBAN1 TRMT1L FTH1P25 lnc-TRMT1L-3
GH01J185314 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE CraniofacialAtlas 18.6 +270.2 270237 7.3 ZNF217 EP300 CTCF TCF12 SIN3A MYC NRF1 POLR2G USF1 SP1 IVNS1ABP RNF2 LOC100422414 ENSG00000273004 lnc-TRMT1L-4
GH01J185154 Promoter/Enhancer 2.6 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 10.1 +111.2 111234 3.9 FOXK2 ZBTB40 ZNF217 EP300 ZSCAN5C SIN3A NRF1 POLR2G SP1 PHF8 TRMT1L SWT1 lnc-TRMT1L-1 LOC100422414 RNF2 lnc-FAM129A-1
GH01J185015 Enhancer 1.2 FANTOM5 Ensembl ENCODE 16.4 -29.1 -29118 4.2 JUND FOS TRIM28 REST ZNF740 ZNF316 TRIM24 FOSL2 CEBPB ZNF592 RF00001-023 RNA5SP72 SWT1 RNF2 TRMT1L NIBAN1 ENSG00000271387 IVNS1ABP EDEM3 piR-48369-010
GH01J185065 Enhancer 0.9 Ensembl ENCODE 17.3 +25.7 25682 10.6 ZNF585B ZNF316 TRIM28 CEBPG BCOR GATA3 NR2F1 ZNF384 ZNF18 ATF4 FTH1P25 lnc-TRMT1L-3 TRMT1L RNF2 NIBAN1 SWT1
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around RNF2 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for RNF2

Top Transcription factor binding sites by QIAGEN in the RNF2 gene promoter:
  • CREB
  • deltaCREB
  • Nkx2-5
  • Sp1

Genomic Locations for RNF2 Gene

Genomic Locations for RNF2 Gene
chr1:185,045,419-185,102,608
(GRCh38/hg38)
Size:
57,190 bases
Orientation:
Plus strand
chr1:185,014,496-185,071,740
(GRCh37/hg19)
Size:
57,245 bases
Orientation:
Plus strand

Genomic View for RNF2 Gene

Genes around RNF2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RNF2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RNF2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RNF2 Gene

Proteins for RNF2 Gene

  • Protein details for RNF2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q99496-RING2_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase RING2
    Protein Accession:
    Q99496
    Secondary Accessions:
    • B2RBS7
    • B3KRH1
    • Q5TEN1
    • Q5TEN2

    Protein attributes for RNF2 Gene

    Size:
    336 amino acids
    Molecular mass:
    37655 Da
    Quaternary structure:
    • Component of chromatin-associated Polycomb (PcG) complexes. Component of a number of PRC1-like complexes; these complexes contain either the polycomb group ring finger protein PCGF1, or PCGF2, or PCGF3, or PCGF4, or PCGF5, or PCGF6 (PubMed:12167701, PubMed:15386022, PubMed:19636380, PubMed:21282530, PubMed:26687479, PubMed:26151332). Part of a complex that contains RNF2, UB2D3 and BMI1; within that complex RNF2 and BMI1 form a tight heterodimer, where UB2D3 interacts only with RNF2 (PubMed:21772249, PubMed:25355358). The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A (PubMed:21772249). Part of a complex that contains PCGF5, RNF2 and UBE2D3 (PubMed:26151332). Part of a complex that contains AUTS2, PCGF5, RNF2, CSNK2B AND RYBP (PubMed:25519132). Interacts with RYBP, PCGF2, CBX4, CBX6, CBX7 and CBX8 (PubMed:19636380, PubMed:21282530, PubMed:19791798, PubMed:20696397). Interacts with RNF1/RING1, BMI1 and PHC2 (PubMed:15386022, PubMed:16714294). Interaction with RYBP and CBX7 is mutually exclusive; both compete for the same binding site on RNF2 (By similarity). Component of repressive BCOR complex containing a Polycomb group subcomplex at least composed of RYBP, PCGF1, BCOR and RING1 (PubMed:16943429). Interacts with CBX2 and PHC1. Interacts with CHTOP. Interacts with AURKB (By similarity). Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RNF1/RING1, RNF2/RING2, MBLR, L3MBTL2 and YAF2 (PubMed:12004135). Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10 (PubMed:15960975). Interacts with RYBP, HIP2 and TFCP2 (PubMed:11513855, PubMed:11865070, PubMed:20696397). Interacts with NUPR1 (PubMed:28720707).
    Miscellaneous:
    • The hPRC-H complex purification reported by PubMed:12167701 probably presents a mixture of different PRC1-like complexes.

    Three dimensional structures from OCA and Proteopedia for RNF2 Gene

    Alternative splice isoforms for RNF2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RNF2 Gene

Selected DME Specific Peptides for RNF2 Gene

Q99496:
  • VSPRSLHSELMCPICLDMLKNTMTTKECLHRFC
  • KHNNQQALSHSIEEGLKIQAMNRLQRGKK
  • KRTKTSDDSGL
  • NATVDHLSKYLA
  • QIENGSGAEDNGDSSHCSNAS
  • EIELVFR
  • WKVNKPME
  • KTWELSLYEL
  • TALRSGNKECPTCRKKLVSKRSLRPDPNFDALIS
  • ELYYAPTKE
  • HSNQEAGPS
  • SEKQYTIYI
  • LISKIYPSR

Post-translational modifications for RNF2 Gene

  • Polyubiquitinated in the presence of UBE2D3 (in vitro).
  • Monoubiquitinated, by auto-ubiquitination.
  • Ubiquitination at Lys112, Lys149, Lys249, Lys261, and Lys323
  • Modification sites at PhosphoSitePlus

Other Protein References for RNF2 Gene

Domains & Families for RNF2 Gene

Gene Families for RNF2 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for RNF2 Gene

Blocks:
  • Zn-finger, RING
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for RNF2 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ34255 fis, clone FCBBF5000353, highly similar to Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger protein 2) (B3KRH1_HUMAN)
  • RING finger protein BAP-1 (RING2_HUMAN)
genes like me logo Genes that share domains with RNF2: view

No data available for Graphical View of Domain Structure and UniProtKB/Swiss-Prot for RNF2 Gene

Function for RNF2 Gene

Molecular function for RNF2 Gene

UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation (PubMed:15386022, PubMed:16359901, PubMed:25519132, PubMed:21772249, PubMed:25355358, PubMed:26151332). H2AK119Ub gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation (By similarity). Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed:16359901, PubMed:26151332). PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility (PubMed:26151332). E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4 (PubMed:21772249). Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity (Probable). Association with the chromosomal DNA is cell-cycle dependent. In resting B- and T-lymphocytes, interaction with AURKB leads to block its activity, thereby maintaining transcription in resting lymphocytes (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27; Evidence={ECO:0000269 PubMed:15386022, ECO:0000269 PubMed:21772249, ECO:0000269 PubMed:26151332};.

Enzyme Numbers (IUBMB) for RNF2 Gene

Phenotypes From GWAS Catalog for RNF2 Gene

Gene Ontology (GO) - Molecular Function for RNF2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003682 chromatin binding IDA 25519132
GO:0004842 contributes_to ubiquitin-protein transferase activity IDA 16714294
GO:0005515 protein binding IPI 10369680
GO:0008270 zinc ion binding IDA 16714294
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with RNF2: view
genes like me logo Genes that share phenotypes with RNF2: view

Animal Models for RNF2 Gene

MGI Knock Outs for RNF2:

Animal Model Products

CRISPR Products

Clone Products

  • Addgene plasmids for RNF2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for RNF2 Gene

Localization for RNF2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RNF2 Gene

Nucleus. Chromosome. Note=Enriched on inactive X chromosome (Xi) in female trophoblast stem (TS) cells as well as differentiating embryonic stem (ES) cells. The enrichment on Xi is transient during TS and ES cell differentiation. The association with Xi is mitotically stable in non-differentiated TS cells. {ECO:0000250 UniProtKB:Q9CQJ4}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RNF2 gene
Compartment Confidence
nucleus 5
cytoskeleton 2
plasma membrane 1
extracellular 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
cytosol 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nucleoplasm (4)
  • Nuclear bodies (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for RNF2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000151 ubiquitin ligase complex IDA,IEA 16714294
GO:0000791 euchromatin IEA --
GO:0000792 heterochromatin IEA --
GO:0001739 sex chromatin IEA --
GO:0005634 nucleus IEA,IDA 18629613
genes like me logo Genes that share ontologies with RNF2: view

Pathways & Interactions for RNF2 Gene

genes like me logo Genes that share pathways with RNF2: view

Pathways by source for RNF2 Gene

UniProtKB/Swiss-Prot Q99496-RING2_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

SIGNOR curated interactions for RNF2 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for RNF2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription by RNA polymerase II ISS --
GO:0000278 mitotic cell cycle IEA --
GO:0001702 gastrulation with mouth forming second IEA --
GO:0007281 germ cell development IEA --
GO:0009948 anterior/posterior axis specification IEA --
genes like me logo Genes that share ontologies with RNF2: view

Drugs & Compounds for RNF2 Gene

(3) Drugs for RNF2 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved, Investigational Nutra 0
ATP Investigational Nutra Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation 0

(1) Additional Compounds for RNF2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • [(ho)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • PYROphosphATE
14000-31-8
genes like me logo Genes that share compounds with RNF2: view

Transcripts for RNF2 Gene

mRNA/cDNA for RNF2 Gene

1 REFSEQ mRNAs :
9 NCBI additional mRNA sequence :
4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

  • Addgene plasmids for RNF2

Alternative Splicing Database (ASD) splice patterns (SP) for RNF2 Gene

ExUns: 1 ^ 2a · 2b · 2c · 2d · 2e ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10a · 10b ^ 11a · 11b · 11c
SP1: - -
SP2: - - - - -
SP3: -
SP4: - -
SP5: - - - - - - -
SP6: - - - - - -
SP7: -
SP8: -

Relevant External Links for RNF2 Gene

GeneLoc Exon Structure for
RNF2

Expression for RNF2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for RNF2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for RNF2 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (24.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for RNF2 Gene



Protein tissue co-expression partners for RNF2 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for RNF2

SOURCE GeneReport for Unigene cluster for RNF2 Gene:

Hs.591490

Evidence on tissue expression from TISSUES for RNF2 Gene

  • Nervous system(4.5)
genes like me logo Genes that share expression patterns with RNF2: view

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for RNF2 Gene

Orthologs for RNF2 Gene

This gene was present in the common ancestor of animals.

Orthologs for RNF2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia RNF2 31 30
  • 99.9 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia RNF2 31
  • 97 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia RNF2 31
  • 97 (a)
OneToOne
dog
(Canis familiaris)
Mammalia RNF2 31 30
  • 95.83 (n)
OneToOne
cow
(Bos Taurus)
Mammalia RNF2 31 30
  • 95.34 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Rnf2 17 31 30
  • 92.16 (n)
rat
(Rattus norvegicus)
Mammalia Rnf2 30
  • 90.35 (n)
chicken
(Gallus gallus)
Aves RNF2 31 30
  • 84.42 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia RNF2 31
  • 98 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia rnf2 30
  • 80.75 (n)
Str.682 30
African clawed frog
(Xenopus laevis)
Amphibia LOC398559 30
zebrafish
(Danio rerio)
Actinopterygii rnf2 31 30 30
  • 72.42 (n)
OneToOne
fruit fly
(Drosophila melanogaster)
Insecta Ring 32
  • 80 (a)
Sce 31 30
  • 57.71 (n)
OneToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP002073 30
  • 58.72 (n)
worm
(Caenorhabditis elegans)
Secernentea spat-3 31
  • 3 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.9967 31
  • 47 (a)
OneToMany
Cin.4640 30
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.4640 30
Species where no ortholog for RNF2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for RNF2 Gene

ENSEMBL:
Gene Tree for RNF2 (if available)
TreeFam:
Gene Tree for RNF2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for RNF2: view image

Paralogs for RNF2 Gene

Paralogs for RNF2 Gene

(1) SIMAP similar genes for RNF2 Gene using alignment to 2 proteins:

  • RING2_HUMAN
  • B3KRH1_HUMAN

Pseudogenes.org Pseudogenes for RNF2 Gene

genes like me logo Genes that share paralogs with RNF2: view

Variants for RNF2 Gene

Additional dbSNP identifiers (rs#s) for RNF2 Gene

Structural Variations from Database of Genomic Variants (DGV) for RNF2 Gene

Variant ID Type Subtype PubMed ID
esv3588134 CNV loss 21293372
nsv525731 CNV gain 19592680
nsv548396 CNV loss 21841781

Variation tolerance for RNF2 Gene

Residual Variation Intolerance Score: 50.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.49; 10.63% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for RNF2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
RNF2

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for RNF2 Gene

Disorders for RNF2 Gene

MalaCards: The human disease database

(2) MalaCards diseases for RNF2 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
angelman syndrome
  • as
trichothiodystrophy 1, photosensitive
  • amish brittle hair brain syndrome
- elite association - COSMIC cancer census association via MalaCards
Search RNF2 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for RNF2

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with RNF2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for RNF2 Gene

Publications for RNF2 Gene

  1. E3 ligase activity of RING finger proteins that interact with Hip-2, a human ubiquitin-conjugating enzyme. (PMID: 11513855) Lee SJ … Kang S (FEBS letters 2001) 2 3 4 23 54
  2. Structure of a Bmi-1-Ring1B polycomb group ubiquitin ligase complex. (PMID: 16714294) Li Z … Xu RM (The Journal of biological chemistry 2006) 3 4 23 54
  3. Intrinsically disordered chromatin protein NUPR1 binds to the C-terminal region of Polycomb RING1B. (PMID: 28720707) Santofimia-Castaño P … Neira JL (Proceedings of the National Academy of Sciences of the United States of America 2017) 3 4 54
  4. The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis. (PMID: 26687479) Oliviero G … Cagney G (Scientific reports 2015) 3 4 54
  5. BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase. (PMID: 26151332) Taherbhoy AM … Cochran AG (Nature communications 2015) 3 4 54

Products for RNF2 Gene

Sources for RNF2 Gene