Aliases for RNF2 Gene
Aliases for RNF2 Gene
External Ids for RNF2 Gene
- HGNC: 10061
- Entrez Gene: 6045
- Ensembl: ENSG00000121481
- OMIM: 608985
- UniProtKB: Q99496
Previous GeneCards Identifiers for RNF2 Gene
- GC01P182540
- GC01P180442
- GC01P181534
- GC01P182253
- GC01P181746
- GC01P183281
- GC01P185014
- GC01P156249
Summaries for RNF2 Gene
-
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq, Jul 2008]
GeneCards Summary for RNF2 Gene
RNF2 (Ring Finger Protein 2) is a Protein Coding gene. Diseases associated with RNF2 include Angelman Syndrome. Among its related pathways are Metabolism of proteins and SUMOylation. Gene Ontology (GO) annotations related to this gene include chromatin binding and ubiquitin-protein transferase activity.
UniProtKB/Swiss-Prot for RNF2 Gene
-
E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation (PubMed:15386022, PubMed:16359901, PubMed:25519132, PubMed:21772249, PubMed:25355358, PubMed:26151332). H2AK119Ub gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation (By similarity). Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed:16359901, PubMed:26151332). PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility (PubMed:26151332). E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4 (PubMed:21772249). Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity (Probable). Association with the chromosomal DNA is cell-cycle dependent. In resting B- and T-lymphocytes, interaction with AURKB leads to block its activity, thereby maintaining transcription in resting lymphocytes (By similarity).
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RNF2 Gene
Genomics for RNF2 Gene
GeneHancer (GH) Regulatory Elements for RNF2 Gene
- Top Transcription factor binding sites by QIAGEN in the RNF2 gene promoter:
-
- CREB
- deltaCREB
- Nkx2-5
- Sp1
Genomic Locations for RNF2 Gene
- chr1:185,045,364-185,102,608
- (GRCh38/hg38)
- Size:
- 57,245 bases
- Orientation:
- Plus strand
- chr1:185,014,496-185,071,740
- (GRCh37/hg19)
- Size:
- 57,245 bases
- Orientation:
- Plus strand
Genomic View for RNF2 Gene
- Cytogenetic band:
-
- 1q25.3 by HGNC
- 1q25.3 by Entrez Gene
- 1q25.3 by Ensembl


RefSeq DNA sequence for RNF2 Gene
Proteins for RNF2 Gene
-
Protein details for RNF2 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q99496-RING2_HUMAN
- Recommended name:
- E3 ubiquitin-protein ligase RING2
- Protein Accession:
- Q99496
- B2RBS7
- B3KRH1
- Q5TEN1
- Q5TEN2
Protein attributes for RNF2 Gene
- Size:
- 336 amino acids
- Molecular mass:
- 37655 Da
- Quaternary structure:
-
- Component of chromatin-associated Polycomb (PcG) complexes. Component of a number of PRC1-like complexes; these complexes contain either the polycomb group ring finger protein PCGF1, or PCGF2, or PCGF3, or PCGF4, or PCGF5, or PCGF6 (PubMed:12167701, PubMed:15386022, PubMed:19636380, PubMed:21282530, PubMed:26687479, PubMed:26151332). Part of a complex that contains RNF2, UB2D3 and BMI1; within that complex RNF2 and BMI1 form a tight heterodimer, where UB2D3 interacts only with RNF2 (PubMed:21772249, PubMed:25355358). The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A (PubMed:21772249). Part of a complex that contains PCGF5, RNF2 and UBE2D3 (PubMed:26151332). Part of a complex that contains AUTS2, PCGF5, RNF2, CSNK2B AND RYBP (PubMed:25519132). Interacts with RYBP, PCGF2, CBX4, CBX6, CBX7 and CBX8 (PubMed:19636380, PubMed:21282530, PubMed:19791798, PubMed:20696397). Interacts with RNF1/RING1, BMI1 and PHC2 (PubMed:15386022, PubMed:16714294). Interaction with RYBP and CBX7 is mutually exclusive; both compete for the same binding site on RNF2 (By similarity). Component of repressive BCOR complex containing a Polycomb group subcomplex at least composed of RYBP, PCGF1, BCOR and RING1 (PubMed:16943429). Interacts with CBX2 and PHC1. Interacts with CHTOP. Interacts with AURKB (By similarity). Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RNF1/RING1, RNF2/RING2, MBLR, L3MBTL2 and YAF2 (PubMed:12004135). Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10 (PubMed:15960975). Interacts with RYBP, HIP2 and TFCP2 (PubMed:11513855, PubMed:11865070, PubMed:20696397).
- Miscellaneous:
-
- The hPRC-H complex purification reported by PubMed:12167701 probably presents a mixture of different PRC1-like complexes.
Three dimensional structures from OCA and Proteopedia for RNF2 Gene
Protein Expression for RNF2 Gene
Selected DME Specific Peptides for RNF2 Gene
- Q99496:
-
- VSPRSLHSELMCPICLDMLKNTMTTKECLHRFC
- KHNNQQALSHSIEEGLKIQAMNRLQRGKK
- KRTKTSDDSGL
- NATVDHLSKYLA
- QIENGSGAEDNGDSSHCSNAS
- EIELVFR
- WKVNKPME
- KTWELSLYEL
- TALRSGNKECPTCRKKLVSKRSLRPDPNFDALIS
- ELYYAPTKE
- HSNQEAGPS
- SEKQYTIYI
- LISKIYPSR
Post-translational modifications for RNF2 Gene
- Polyubiquitinated in the presence of UBE2D3 (in vitro).
- Monoubiquitinated, by auto-ubiquitination.
- Ubiquitination at posLast=323323, Lys261, Lys249, posLast=149149, and Lys112
- Modification sites at PhosphoSitePlus
Other Protein References for RNF2 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for RNF2 (RNF2)
- Novus Biologicals Antibodies for RNF2
-
Abcam antibodies for RNF2
- Invitrogen Antibodies for RNF2 (AFLGC-RNF2)
-
Santa Cruz Biotechnology (SCBT) Antibodies for RNF2
- Sino Biological Antibodies for RNF2
Protein Products
-
OriGene Purified Proteins for RNF2
- Search Origene for MassSpec and Protein Over-expression Lysates for RNF2
- Origene Custom Protein Services for RNF2
- antibodies-online: Search results for 7 available RNF2 Proteins ranked by validation data
- Compare Top RNF2 Proteins
-
Quality Products:
-
Abcam proteins for RNF2
Assay Products
- antibodies-online: Search results for 1 available RNF2 Elisa Kits ranked by validation data
- Compare Top RNF2 Elisa Kits
-
Quality Products:
Domains & Families for RNF2 Gene
Gene Families for RNF2 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
Protein Domains for RNF2 Gene
- Blocks:
- InterPro:
- ProtoNet:
Suggested Antigen Peptide Sequences for RNF2 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
No data available for UniProtKB/Swiss-Prot for RNF2 Gene
Function for RNF2 Gene
Molecular function for RNF2 Gene
- UniProtKB/Swiss-Prot Function:
- E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation (PubMed:15386022, PubMed:16359901, PubMed:25519132, PubMed:21772249, PubMed:25355358, PubMed:26151332). H2AK119Ub gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation (By similarity). Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed:16359901, PubMed:26151332). PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility (PubMed:26151332). E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4 (PubMed:21772249). Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity (Probable). Association with the chromosomal DNA is cell-cycle dependent. In resting B- and T-lymphocytes, interaction with AURKB leads to block its activity, thereby maintaining transcription in resting lymphocytes (By similarity).
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
Enzyme Numbers (IUBMB) for RNF2 Gene
Phenotypes From GWAS Catalog for RNF2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0003682 | chromatin binding | IDA | 25519132 |
GO:0004842 | contributes_to ubiquitin-protein transferase activity | IDA | 16714294 |
GO:0005515 | protein binding | IPI | 10369680 |
GO:0008270 | zinc ion binding | IDA | 16714294 |
GO:0016740 | transferase activity | IEA | -- |
Phenotypes for RNF2 Gene
- MGI mutant phenotypes for RNF2:
-
inferred from 6 alleles
- nervous system phenotype
- behavior/neurological phenotype
- no phenotypic analysis
- neoplasm
- mortality/aging
- cellular phenotype
- liver/biliary system phenotype
- reproductive system phenotype
- skeleton phenotype
- embryo phenotype
- hematopoietic system phenotype
- immune system phenotype
- growth/size/body region phenotype
- GenomeRNAi human phenotypes for RNF2:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for RNF2
-
CRISPR Products
-
OriGene CRISPR knockouts for RNF2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for RNF2
- genomics-online: gRNA clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
- Applied Biological Materials (abm): CRISPR Clones for RNF2 - Now 50% OFF >
- * RNF2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * RNF2 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
Santa Cruz Biotechnology (SCBT) CRISPR for RNF2
miRNA for RNF2 Gene
- miRTarBase miRNAs that target RNF2
-
- hsa-mir-200b-3p (MIRT006163)
- hsa-mir-200c-3p (MIRT006164)
- hsa-mir-181a-5p (MIRT006166)
- hsa-mir-181b-5p (MIRT006167)
- hsa-mir-155-5p (MIRT021040)
- hsa-mir-186-5p (MIRT021180)
- hsa-mir-26b-5p (MIRT030193)
- hsa-mir-24-3p (MIRT030624)
- hsa-mir-92a-3p (MIRT049365)
- hsa-mir-149-5p (MIRT268871)
- hsa-mir-6504-5p (MIRT554687)
- hsa-mir-4284 (MIRT554688)
- hsa-mir-3064-5p (MIRT554689)
- hsa-mir-664a-5p (MIRT554690)
- hsa-mir-4794 (MIRT554691)
- hsa-mir-7844-5p (MIRT554692)
- hsa-mir-3607-3p (MIRT619337)
- hsa-mir-10b-5p (MIRT619338)
- hsa-mir-10a-5p (MIRT619339)
- hsa-mir-6732-3p (MIRT619340)
- hsa-mir-548as-3p (MIRT619341)
- hsa-mir-548x-3p (MIRT625957)
- hsa-mir-548j-3p (MIRT625958)
- hsa-mir-548aq-3p (MIRT625959)
- hsa-mir-548am-3p (MIRT625960)
- hsa-mir-548aj-3p (MIRT625961)
- hsa-mir-548ah-3p (MIRT625962)
- hsa-mir-548ae-3p (MIRT625963)
- hsa-mir-548z (MIRT625964)
- hsa-mir-548h-3p (MIRT625965)
- hsa-mir-548d-3p (MIRT625966)
- hsa-mir-548bb-3p (MIRT625967)
- hsa-mir-548ac (MIRT625968)
- hsa-mir-524-5p (MIRT639417)
- hsa-mir-520d-5p (MIRT639418)
- hsa-mir-3613-3p (MIRT639419)
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for RNF2
- Browse OriGene Inhibitory RNA Products For RNF2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF2
- genomics-online: shRNA clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
Clone Products
-
- MG226095
- MR226095
- MR226095L1
- MR226095L1V
- MR226095L2
- MR226095L2V
- MR226095L3
- MR226095L3V
- MR226095L4
- MR226095L4V
- RC203089
- RC203089L1
- RC203089L1V
- RC203089L2
- RC203089L2V
- RC203089L3
- RC203089L3V
- RC203089L4
- RC203089L4V
- RC503089
- RG203089
- RR207712
- RR207712L1
- RR207712L1V
- RR207712L2
- RR207712L2V
- RR207712L3
- RR207712L3V
- RR207712L4
- RR207712L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for RNF2
- Addgene plasmids for RNF2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for RNF2
- Applied Biological Materials (abm): Clones for RNF2 - Now 50% OFF >
- * RNF2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * RNF2 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
Cell Line Products
-
Horizon Cell Lines for RNF2
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for RNF2 Gene
Localization for RNF2 Gene
Subcellular locations from UniProtKB/Swiss-Prot for RNF2 Gene
- Nucleus. Chromosome. Note=Enriched on inactive X chromosome (Xi) in female trophoblast stem (TS) cells as well as differentiating embryonic stem (ES) cells. The enrichment on Xi is transient during TS and ES cell differentiation. The association with Xi is mitotically stable in non-differentiated TS cells. {ECO:0000250 UniProtKB:Q9CQJ4}.
- Nucleoplasm (4)
- Nuclear bodies (3)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000151 | ubiquitin ligase complex | IDA | 16714294 |
GO:0000791 | euchromatin | IEA | -- |
GO:0000792 | heterochromatin | IEA | -- |
GO:0001739 | sex chromatin | IEA | -- |
GO:0005634 | nucleus | IDA,IEA | 18629613 |
Pathways & Interactions for RNF2 Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | Cellular Senescence (REACTOME) | ||
2 | SUMOylation |
.95
|
|
3 | Metabolism of proteins | ||
4 | Chromatin Regulation / Acetylation | ||
5 | DNA Damage |
Pathways by source for RNF2 Gene
9 Reactome pathways for RNF2 Gene
2 Cell Signaling Technology pathways for RNF2 Gene
UniProtKB/Swiss-Prot Q99496-RING2_HUMAN
- Pathway: Protein modification; protein ubiquitination.
Interacting Proteins for RNF2 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000122 | negative regulation of transcription by RNA polymerase II | ISS | -- |
GO:0000278 | mitotic cell cycle | IEA | -- |
GO:0001702 | gastrulation with mouth forming second | IEA | -- |
GO:0007281 | germ cell development | IEA | -- |
GO:0009948 | anterior/posterior axis specification | IEA | -- |
Drugs & Compounds for RNF2 Gene
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
pyrophosphate |
|
14000-31-8 |
|
Drug Products
Transcripts for RNF2 Gene
mRNA/cDNA for RNF2 Gene
- (1) REFSEQ mRNAs :
- (9) Additional mRNA sequences :
- (97) Selected AceView cDNA sequences:
- (4) Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000367509 1677 bps (uc001grd.2)
- ENST00000367510 3606 bps (uc001grc.2)
- ENST00000453650 939 bps (uc057nxn.1)
- ENST00000498201 631 bps (uc057nxm.1)
CRISPR Products
-
OriGene CRISPR knockouts for RNF2
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for RNF2
- genomics-online: gRNA clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
- Applied Biological Materials (abm): CRISPR Clones for RNF2 - Now 50% OFF >
- * RNF2 CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * RNF2 CRISPR applications: KO, Activation, Repression, and more - Browse All
-
Santa Cruz Biotechnology (SCBT) CRISPR for RNF2
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for RNF2
- Browse OriGene Inhibitory RNA Products For RNF2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF2
- genomics-online: shRNA clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
Clone Products
-
- MG226095
- MR226095
- MR226095L1
- MR226095L1V
- MR226095L2
- MR226095L2V
- MR226095L3
- MR226095L3V
- MR226095L4
- MR226095L4V
- RC203089
- RC203089L1
- RC203089L1V
- RC203089L2
- RC203089L2V
- RC203089L3
- RC203089L3V
- RC203089L4
- RC203089L4V
- RC503089
- RG203089
- RR207712
- RR207712L1
- RR207712L1V
- RR207712L2
- RR207712L2V
- RR207712L3
- RR207712L3V
- RR207712L4
- RR207712L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for RNF2
- Addgene plasmids for RNF2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for RNF2
- Applied Biological Materials (abm): Clones for RNF2 - Now 50% OFF >
- * RNF2 as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * RNF2 tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
ExUns: | 1 | ^ | 2a | · | 2b | · | 2c | · | 2d | · | 2e | ^ | 3 | ^ | 4 | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11a | · | 11b | · | 11c |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | |||||||||||||||||||||||||||||||||||
SP2: | - | - | - | - | - | ||||||||||||||||||||||||||||||||
SP3: | - | ||||||||||||||||||||||||||||||||||||
SP4: | - | - | |||||||||||||||||||||||||||||||||||
SP5: | - | - | - | - | - | - | - | ||||||||||||||||||||||||||||||
SP6: | - | - | - | - | - | - | |||||||||||||||||||||||||||||||
SP7: | - | ||||||||||||||||||||||||||||||||||||
SP8: | - |
Expression for RNF2 Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
-
Gonad (Reproductive System)
- Primordial Germ Cells Primitive Gonad
- Neural Tube (Nervous System)
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for RNF2 Gene
NURSA nuclear receptor signaling pathways regulating expression of RNF2 Gene:
RNF2SOURCE GeneReport for Unigene cluster for RNF2 Gene:
Hs.591490Evidence on tissue expression from TISSUES for RNF2 Gene
- Nervous system(4.5)
Primer Products
-
OriGene qPCR primer pairs for RNF2
-
OriGene qPCR primer pairs and template standards for RNF2
Gene Expression Assay Products
No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for RNF2 Gene
Orthologs for RNF2 Gene
This gene was present in the common ancestor of animals.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | RNF2 35 34 |
|
OneToOne | |
oppossum (Monodelphis domestica) |
Mammalia | RNF2 35 |
|
OneToOne | |
platypus (Ornithorhynchus anatinus) |
Mammalia | RNF2 35 |
|
OneToOne | |
dog (Canis familiaris) |
Mammalia | RNF2 35 34 |
|
OneToOne | |
cow (Bos Taurus) |
Mammalia | RNF2 35 34 |
|
OneToOne | |
mouse (Mus musculus) |
Mammalia | Rnf2 17 35 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Rnf2 34 |
|
||
chicken (Gallus gallus) |
Aves | RNF2 35 34 |
|
OneToOne | |
lizard (Anolis carolinensis) |
Reptilia | RNF2 35 |
|
OneToOne | |
tropical clawed frog (Silurana tropicalis) |
Amphibia | rnf2 34 |
|
||
Str.682 34 |
|
||||
African clawed frog (Xenopus laevis) |
Amphibia | LOC398559 34 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | rnf2 35 34 34 |
|
OneToOne | |
fruit fly (Drosophila melanogaster) |
Insecta | Ring 36 |
|
|
|
Sce 35 34 |
|
OneToMany | |||
African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP002073 34 |
|
||
worm (Caenorhabditis elegans) |
Secernentea | spat-3 35 |
|
OneToMany | |
sea squirt (Ciona savignyi) |
Ascidiacea | CSA.9967 35 |
|
OneToMany | |
Cin.4640 34 |
|
||||
sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.4640 34 |
|
- Species where no ortholog for RNF2 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Evolution for RNF2 Gene
- ENSEMBL:
- Gene Tree for RNF2 (if available)
- TreeFam:
- Gene Tree for RNF2 (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for RNF2: view image
Paralogs for RNF2 Gene
(1) SIMAP similar genes for RNF2 Gene using alignment to 2 proteins:
- RING2_HUMAN
- B3KRH1_HUMAN
Pseudogenes.org Pseudogenes for RNF2 Gene
No data available for Paralogs for RNF2 Gene
Variants for RNF2 Gene
SNP ID | Clin | Chr 01 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1000092836 | -- | 185,102,313(+) | G/C | 3_prime_UTR_variant, downstream_transcript_variant, genic_downstream_transcript_variant | |
rs1000106561 | -- | 185,073,339(+) | T/A/C | intron_variant | |
rs1000152528 | -- | 185,089,970(+) | G/A | intron_variant | |
rs1000284586 | -- | 185,096,793(+) | C/G | intron_variant | |
rs1000356663 | -- | 185,094,394(+) | G/A | intron_variant |
Additional Variant Information for RNF2 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- RNF2
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RNF2 Gene
Disorders for RNF2 Gene
Disorder | Aliases | PubMed IDs |
---|---|---|
angelman syndrome |
|
|
Additional Disease Information for RNF2
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for UniProtKB/Swiss-Prot and Genatlas for RNF2 Gene
Publications for RNF2 Gene
- E3 ligase activity of RING finger proteins that interact with Hip-2, a human ubiquitin-conjugating enzyme. (PMID: 11513855) Lee SJ … Kang S (FEBS letters 2001) 2 3 4 23 58
- Structure of a Bmi-1-Ring1B polycomb group ubiquitin ligase complex. (PMID: 16714294) Li Z … Xu RM (The Journal of biological chemistry 2006) 3 4 23 58
- The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis. (PMID: 26687479) Oliviero G … Cagney G (Scientific reports 2015) 3 4 58
- BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase. (PMID: 26151332) Taherbhoy AM … Cochran AG (Nature communications 2015) 3 4 58
- An AUTS2-Polycomb complex activates gene expression in the CNS. (PMID: 25519132) Gao Z … Reinberg D (Nature 2014) 3 4 58
Products for RNF2 Gene
- R&D Systems Antibodies for RNF2 (RNF2)
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for RNF2
- Search Origene for MassSpec and Protein Over-expression Lysates for RNF2
- Origene Custom Protein Services for RNF2
- Origene RNAi, shrna, and sirna products in human, mouse, rat for RNF2
- Browse OriGene Inhibitory RNA Products For RNF2
- OriGene qPCR primer pairs for RNF2
- OriGene qPCR primer pairs and template standards for RNF2
- OriGene CRISPR knockouts for RNF2
- MG226095
- MR226095
- MR226095L1
- MR226095L2
- MR226095L3
- MR226095L4
- RC203089
- RC203089L1
- RC203089L2
- RC203089L3
- RC203089L4
- RC503089
- RG203089
- RR207712
- RR207712L1
- RR207712L2
- RR207712L3
- RR207712L4
- MR226095L1V
- MR226095L2V
- MR226095L3V
- MR226095L4V
- RC203089L1V
- RC203089L2V
- RC203089L3V
- RC203089L4V
- RR207712L1V
- RR207712L2V
- RR207712L3V
- RR207712L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For RNF2
- Sino Biological Human cDNA Clone for RNF2
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for RNF2
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for RNF2
- Novus Biologicals lysates and proteins for RNF2
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for RNF2
- Abcam proteins for RNF2
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for RNF2 (AFLGC-RNF2)
- Cyagen custom Knockout/knockin (KOKI) mouse models for RNF2
- Addgene plasmids for RNF2
- antibodies-online: Search results for 64 available RNF2 Antibodies ranked by validation data
- Compare Top RNF2 Antibodies
- antibodies-online: Search results for 1 available RNF2 Elisa Kits ranked by validation data
- Compare Top RNF2 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 7 available RNF2 Proteins ranked by validation data
- Compare Top RNF2 Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for RNF2
- Search Santa Cruz Biotechnology (SCBT) for RNF2 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for RNF2
- Horizon Cell Lines for RNF2
- genomics-online: cdna clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
- orf clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
- genomics-online: gRNA clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
- genomics-online: primer clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
- genomics-online: shRNA clones - Search results for 114 available RNF2 gene related products
- Overview of 114 available RNF2 gene related products
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for RNF2
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for RNF2
- GeneCopoeia miRNA 3'UTR Target clone products for RNF2
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RNF2
Sources for RNF2 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) UniGene
- (28) AceView
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) HGMD
- (45) GAD
- (46) BGMUT
- (47) HuGE
- (48) Atlas
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) OCA
- (69) Proteopedia
- (70) MOPED
- (71) neXtProt
- (72) Reactome
- (73) GeneGo (Thomson Reuters)
- (74) fRNAdb
- (75) DISEASES
- (76) SIMAP
- (77) GenomeRNAi
- (78) LifeMap
- (79) miRTarBase
- (80) MalaCards
- (81) Invitrogen
- (82) BitterDB
- (83) ESI-BIO
- (84) RefSeq
- (85) BioSystems
- (86) MaxQB
- (87) IUPHAR
- (88) BioGPS
- (89) Illumina
- (90) COMPARTMENTS
- (91) HOMER
- (92) PaxDb
- (93) ApexBio
- (94) Addgene
- (95) antibodies-online
- (96) CYP
- (97) NONCODE
- (98) SwitchGear Genomics
- (99) TreeFam
- (100) PathCards
- (101) GeneReviews
- (102) GeneTex
- (103) Taconic Biosciences
- (104) GTEx
- (105) ProteomicsDB
- (106) SCBT
- (107) DGIdb
- (108) ClinicalTrials
- (109) FDA Approved Drugs
- (110) RVIS
- (111) SIGNOR
- (112) diseasecard
- (113) NIH Rare Diseases
- (114) Orphanet
- (115) UMLS
- (116) GTR
- (117) Disease Ontology
- (118) Genetics Home Reference
- (119) MeSH
- (120) MedlinePlus
- (121) CDC
- (122) NINDS
- (123) NCBI Bookshelf
- (124) ClinVar
- (125) Gene Damage Index
- (126) ViGene Biosciences
- (127) HPO
- (128) UDN
- (129) VISTA
- (130) FANTOM5
- (131) ENCODE
- (132) ProSci
- (133) Horizon
- (134) NURSA
- (135) IID
- (136) Cyagen
- (137) VectorBuilder
- (138) SNPedia
- (139) BRCA Exchange
- (140) St John's Lab
- (141) CIViC
- (142) ProteoGenix
- (143) dbSUPER
- (144) TISSUES
- (145) Gene ORGANizer
- (146) abm
- (147) CrownBio
- (148) Human Protein Atlas
- (149) GWAS Catalog
- (150) Monarch Initiative
- (151) DataMed
- (152) HumanCyc
- (153) genomics-online
- (154) UCNEbase
- (155) EPDnew
- (156) Applied Biosystems
- (157) GlyConnect
- (158) Aminode
- (159) GeneCopoeia
- (160) GPS-Prot
- (161) RNACentral
- (162) LncRNADisease
- (163) LOVD
- (164) miR2Disease
- (165) DiseaseEnhancer
- (166) Boster Bio
- (167) Biorbyt
- (168) Biocompare