This gene encodes renin, an aspartic protease that is secreted by the kidneys. Renin is a part of the renin-angiotensin-aldosterone system involved in regulation of blood pressure, and electrolyte balance. This enzyme catalyzes the first step in the activation pathway of angiotensinogen by cleaving angiotensinogen to form angiotensin I, which is then converted to angiotensin II... See more...

Aliases for REN Gene

Aliases for REN Gene

  • Renin 2 3 4 5
  • Angiotensinogenase 3 4
  • EC 3.4.23.15 4 50
  • Angiotensin-Forming Enzyme 3
  • Renin Precursor, Renal 3
  • EC 3.4.23 50
  • ADTKD4 3
  • HNFJ2 3
  • RTD 3
  • REN 5

External Ids for REN Gene

Previous GeneCards Identifiers for REN Gene

  • GC01M201847
  • GC01M199584
  • GC01M200484
  • GC01M201301
  • GC01M200855
  • GC01M202390
  • GC01M204123
  • GC01M175289

Summaries for REN Gene

Entrez Gene Summary for REN Gene

  • This gene encodes renin, an aspartic protease that is secreted by the kidneys. Renin is a part of the renin-angiotensin-aldosterone system involved in regulation of blood pressure, and electrolyte balance. This enzyme catalyzes the first step in the activation pathway of angiotensinogen by cleaving angiotensinogen to form angiotensin I, which is then converted to angiotensin II by angiotensin I converting enzyme. This cascade can result in aldosterone release, narrowing of blood vessels, and increase in blood pressure as angiotension II is a vasoconstrictive peptide. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause hyperuricemic nephropathy familial juvenile 2, familial hyperproreninemia, and renal tubular dysgenesis. [provided by RefSeq, May 2020]

GeneCards Summary for REN Gene

REN (Renin) is a Protein Coding gene. Diseases associated with REN include Tubulointerstitial Kidney Disease, Autosomal Dominant, 4 and Renal Tubular Dysgenesis. Among its related pathways are Agents Acting on the Renin-Angiotensin System Pathway, Pharmacodynamics and Renin secretion. Gene Ontology (GO) annotations related to this gene include signaling receptor binding and endopeptidase activity. An important paralog of this gene is CTSD.

UniProtKB/Swiss-Prot Summary for REN Gene

  • Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.

Gene Wiki entry for REN Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for REN Gene

Genomics for REN Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for REN Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01J204189 Promoter/Enhancer 1 Ensembl ENCODE 258.7 -0.6 -627 2.1 CEBPA ZIC2 CEBPB GABPB1 MYC MXD3 NRF1 HBP1 ZNF48 ZNF18 REN ETNK2 ERLNC1 ENSG00000231691 PLEKHA6 NFASC KISS1
GH01J204166 Promoter 0.4 EPDnew 250.4 +24.0 23967 0.1 ZNF140 RF00017-392 REN ZC3H11A SNRPE MDM4 lnc-ETNK2-1 ETNK2
GH01J204171 Enhancer 1 Ensembl ENCODE 11.4 +18.1 18108 1.7 CEBPA YY1 CEBPB ZNF217 EP300 ELF1 FOXA2 CTBP1 RXRA CUX1 lnc-ETNK2-1 SNRPE ZC3H11A ZBED6 GOLT1A ETNK2 ERLNC1 REN SOX13 ENSG00000231691
GH01J204162 Enhancer 1 Ensembl ENCODE 10.3 +27.8 27764 0.8 ZNF654 CTCF REST DEK TRIM22 MAX ZNF217 SIN3A ELF1 ZNF511 REN RF00017-392 ETNK2 lnc-ETNK2-1
GH01J204195 Promoter/Enhancer 1.2 EPDnew ENCODE 6 -7.4 -7386 4.7 CTCF ZNF148 ELF1 CTBP1 RAD21 NONO PAX8 SMC3 ESRRA SIN3A KISS1 ZC3H11A MDM4 ZBED6 PPP1R15B RBBP5 SNRPE ETNK2 ERLNC1 ENSG00000231691
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around REN on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for REN

Top Transcription factor binding sites by QIAGEN in the REN gene promoter:
  • AP-1
  • ATF-2
  • c-Fos
  • c-Jun
  • CREB
  • deltaCREB

Genomic Locations for REN Gene

Latest Assembly
chr1:204,154,819-204,190,324
(GRCh38/hg38)
Size:
35,506 bases
Orientation:
Minus strand

Previous Assembly
chr1:204,123,947-204,135,465
(GRCh37/hg19 by Entrez Gene)
Size:
11,519 bases
Orientation:
Minus strand

chr1:204,123,944-204,135,465
(GRCh37/hg19 by Ensembl)
Size:
11,522 bases
Orientation:
Minus strand

Genomic View for REN Gene

Genes around REN on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
REN Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for REN Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for REN Gene

Proteins for REN Gene

  • Protein details for REN Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P00797-RENI_HUMAN
    Recommended name:
    Renin
    Protein Accession:
    P00797
    Secondary Accessions:
    • Q6FI38
    • Q6T5C2

    Protein attributes for REN Gene

    Size:
    406 amino acids
    Molecular mass:
    45057 Da
    Quaternary structure:
    • Interacts with ATP6AP2.

    Three dimensional structures from OCA and Proteopedia for REN Gene

    Alternative splice isoforms for REN Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for REN Gene

Selected DME Specific Peptides for REN Gene

P00797:
  • VLGGSDP
  • LKRMPSIRESLKERGVDMARLGPE
  • VVFDTGS
  • IGIGTPPQ
  • LWGSCTFGLP
  • NNRIGFALA
  • TSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVW
  • TVGGITVTQ
  • YTLTSADYV
  • MKGVSVGSSTLLCE
  • DIPPPTGP
  • FIRKFYTEFDR
  • VDTGASYISG
  • FGEVTEMPALPFMLAEFDGVVGMGF
  • LMEALGAK
  • NNRIGFA
  • PTLPDISF

Post-translational modifications for REN Gene

  • Glycosylation at Asn71 and Asn141
  • Modification sites at PhosphoSitePlus
  • Glycosylation from GlyConnect
    • RENI_HUMAN (513)

Other Protein References for REN Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibodies for research

Domains & Families for REN Gene

Gene Families for REN Gene

Human Protein Atlas (HPA):
  • Candidate cardiovascular disease genes
  • Disease related genes
  • Enzymes
  • FDA approved drug targets
  • Predicted intracellular proteins
  • Predicted secreted proteins

Protein Domains for REN Gene

Suggested Antigen Peptide Sequences for REN Gene

GenScript: Design optimal peptide antigens:
  • Angiotensinogenase (RENI_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P00797

UniProtKB/Swiss-Prot:

RENI_HUMAN :
  • Belongs to the peptidase A1 family.
Family:
  • Belongs to the peptidase A1 family.
genes like me logo Genes that share domains with REN: view

Function for REN Gene

Molecular function for REN Gene

UniProtKB/Swiss-Prot Function:
Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=Cleavage of Leu-|-Xaa bond in angiotensinogen to generate angiotensin I.; EC=3.4.23.15;.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=1 uM for angiotensinogen (in absence of ATP6AP2); KM=0.15 uM for angiotensinogen (in presence of membrane-bound ATP6AP2);
UniProtKB/Swiss-Prot EnzymeRegulation:
Interaction with ATP6AP2 results in a 5-fold increased efficiency in angiotensinogen processing.
GENATLAS Biochemistry:
renin,40kDa,angiotensin-forming enzyme

Enzyme Numbers (IUBMB) for REN Gene

Phenotypes From GWAS Catalog for REN Gene

Gene Ontology (GO) - Molecular Function for REN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004175 endopeptidase activity IEA --
GO:0004190 aspartic-type endopeptidase activity IEA,IDA 12045255
GO:0005102 signaling receptor binding IEA,IPI 12045255
GO:0005159 insulin-like growth factor receptor binding IEA --
GO:0005515 protein binding IPI 20927107
genes like me logo Genes that share ontologies with REN: view
genes like me logo Genes that share phenotypes with REN: view

Human Phenotype Ontology for REN Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for REN Gene

MGI Knock Outs for REN:

miRNA for REN Gene

miRTarBase miRNAs that target REN

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for REN

No data available for Transcription Factor Targets and HOMER Transcription for REN Gene

Localization for REN Gene

Subcellular locations from UniProtKB/Swiss-Prot for REN Gene

Secreted. Membrane. Note=Associated to membranes via binding to ATP6AP2.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for REN gene
Compartment Confidence
plasma membrane 5
extracellular 5
cytoskeleton 3
mitochondrion 3
peroxisome 3
nucleus 3
endoplasmic reticulum 3
cytosol 3
lysosome 3
endosome 2
golgi apparatus 2

Gene Ontology (GO) - Cellular Components for REN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region TAS --
GO:0005615 extracellular space IEA,IDA 12045255
GO:0005737 cytoplasm IEA --
GO:0005886 plasma membrane TAS --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with REN: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for REN Gene

Pathways & Interactions for REN Gene

genes like me logo Genes that share pathways with REN: view

Pathways by source for REN Gene

1 Qiagen pathway for REN Gene
  • Renin-Angiotensin Pathway
1 Cell Signaling Technology pathway for REN Gene

SIGNOR curated interactions for REN Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for REN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001822 kidney development IMP 16116425
GO:0001823 mesonephros development IEA --
GO:0002003 angiotensin maturation IBA,TAS --
GO:0002016 regulation of blood volume by renin-angiotensin IEA --
GO:0002018 renin-angiotensin regulation of aldosterone production IEA --
genes like me logo Genes that share ontologies with REN: view

Drugs & Compounds for REN Gene

(126) Drugs for REN Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Aliskiren Approved, Investigational Pharma Target, inhibitor Direct renin inhibitor 0
Lisinopril Approved, Investigational Pharma Target, inhibitor ACE inhibitor 134
Minoxidil Approved, Investigational Pharma Target Kir6 channel (KATP) opener 50
Remikiren Experimental Pharma Target, inhibitor 0
Isopentanol Experimental Pharma Target 0

(44) Additional Compounds for REN Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
sodium
  • Na(+)
  • Na+
  • SODIUM ion
  • Sodium(1+)
7440-23-5
angiotensin I
  • I, angiotensin
  • 5-Ile-angiotensin I

(4) ApexBio Compounds for REN Gene

Compound Action Cas Number
Acetyl Angiotensinogen (1-14), porcine Angiotensinogen precursor 66641-26-7
Aliskiren Direct renin inhibitor 173334-57-1
Aliskiren Hemifumarate 173334-58-2
Angiotensin III (human, mouse) Aldosterone stimulator 13602-53-4
genes like me logo Genes that share compounds with REN: view

Transcripts for REN Gene

mRNA/cDNA for REN Gene

1 REFSEQ mRNAs :
6 NCBI additional mRNA sequence :
2 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for REN

Alternative Splicing Database (ASD) splice patterns (SP) for REN Gene

No ASD Table

Relevant External Links for REN Gene

GeneLoc Exon Structure for
REN

Expression for REN Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for REN Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for REN Gene

This gene is overexpressed in Kidney - Cortex (x43.6).

Protein differential expression in normal tissues from HIPED for REN Gene

This gene is overexpressed in Fetal ovary (45.5), Kidney (15.6), and Fetal testis (7.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for REN Gene



Protein tissue co-expression partners for REN Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for REN

SOURCE GeneReport for Unigene cluster for REN Gene:

Hs.3210

Evidence on tissue expression from TISSUES for REN Gene

  • Intestine(4.5)
  • Kidney(4)
  • Blood(3.7)
  • Heart(3.5)
  • Adrenal gland(3.4)
  • Nervous system(3.2)
  • Urine(3.2)
  • Muscle(3.2)
  • Liver(2.8)
  • Skin(2.6)
  • Thyroid gland(2.4)
  • Pancreas(2.4)
  • Lung(2.3)
  • Bone(2.1)

Phenotype-based relationships between genes and organs from Gene ORGANizer for REN Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • endocrine
  • integumentary
  • nervous
  • reproductive
  • respiratory
  • skeleton
  • urinary
Regions:
Head and neck:
  • brain
  • ear
  • eye
  • face
  • head
  • skull
Thorax:
  • heart
  • lung
Abdomen:
  • kidney
Pelvis:
  • placenta
  • uterus
Limb:
  • ankle
  • digit
  • elbow
  • finger
  • foot
  • hand
  • hip
  • knee
  • lower limb
  • shoulder
  • toe
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • red blood cell
genes like me logo Genes that share expression patterns with REN: view

Primer products for research

No data available for mRNA Expression by UniProt/SwissProt for REN Gene

Orthologs for REN Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for REN Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia REN 29 30
  • 99.51 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia REN 29 30
  • 81.16 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia REN 29 30
  • 80.1 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Ren1 29 16 30
  • 77.47 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Ren 29
  • 76.17 (n)
Oppossum
(Monodelphis domestica)
Mammalia -- 30
  • 57 (a)
OneToMany
-- 30
  • 54 (a)
OneToMany
-- 30
  • 52 (a)
OneToMany
-- 30
  • 51 (a)
OneToMany
-- 30
  • 50 (a)
OneToMany
-- 30
  • 48 (a)
OneToMany
-- 30
  • 42 (a)
OneToMany
Platypus
(Ornithorhynchus anatinus)
Mammalia REN 30
  • 52 (a)
OneToOne
Chicken
(Gallus gallus)
Aves REN 29 30
  • 65.32 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia REN 30
  • 52 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia ren 29
  • 60.79 (n)
Zebrafish
(Danio rerio)
Actinopterygii ren 29 30
  • 58.95 (n)
OneToOne
Fruit Fly
(Drosophila melanogaster)
Insecta CG10104 29 31
  • 49.55 (n)
CG5860 31
  • 36 (a)
pcl 31
  • 35 (a)
Worm
(Caenorhabditis elegans)
Secernentea asp-3 30
  • 33 (a)
ManyToMany
C11D2.2 31
  • 32 (a)
asp-2 31
  • 31 (a)
F59D6.2 31
  • 29 (a)
F28A12.4 31
  • 26 (a)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PEP4 30
  • 33 (a)
OneToMany
Species where no ortholog for REN was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for REN Gene

ENSEMBL:
Gene Tree for REN (if available)
TreeFam:
Gene Tree for REN (if available)
Aminode:
Evolutionary constrained regions (ECRs) for REN: view image
Alliance of Genome Resources:
Additional Orthologs for REN

Paralogs for REN Gene

Paralogs for REN Gene

(7) SIMAP similar genes for REN Gene using alignment to 1 proteins:

  • RENI_HUMAN
genes like me logo Genes that share paralogs with REN: view

Variants for REN Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for REN Gene

SNP ID Clinical significance and condition Chr 01 pos Variation AA Info Type
873768 Uncertain Significance: Renal dysplasia; Hyperuricemic nephropathy, familial juvenile, 2 204,156,267(-) C/T
NM_000537.4(REN):c.871G>A (p.Val291Ile)
MISSENSE
873769 Uncertain Significance: Renal dysplasia; Hyperuricemic nephropathy, familial juvenile, 2 204,156,306(-) A/G
NM_000537.4(REN):c.832T>C (p.Ser278Pro)
MISSENSE
873819 Uncertain Significance: Renal dysplasia; Hyperuricemic nephropathy, familial juvenile, 2 204,161,348(-) C/G
NM_000537.4(REN):c.317G>C (p.Gly106Ala)
MISSENSE
873820 Conflicting Interpretations: Renal dysplasia; Hyperuricemic nephropathy, familial juvenile, 2 204,166,197(-) G/A
NM_000537.4(REN):c.97C>T (p.Arg33Trp)
MISSENSE
874723 Uncertain Significance: Renal dysplasia; Hyperuricemic nephropathy, familial juvenile, 2 204,156,777(-) C/T
NM_000537.4(REN):c.718G>A (p.Gly240Arg)
MISSENSE

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for REN Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for REN Gene

Variant ID Type Subtype PubMed ID
esv2762138 CNV gain 21179565
esv3588613 CNV loss 21293372

Variation tolerance for REN Gene

Residual Variation Intolerance Score: 24% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.23; 24.68% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for REN Gene

Human Gene Mutation Database (HGMD)
REN
SNPedia medical, phenotypic, and genealogical associations of SNPs for
REN
Leiden Open Variation Database (LOVD)
REN

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for REN Gene

Disorders for REN Gene

MalaCards: The human disease database

(198) MalaCards diseases for REN Gene - From: OMI, CVR, GTR, ORP, SWI, COP, and GCD

- elite association - COSMIC cancer census association via MalaCards
Search REN in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

RENI_HUMAN
  • Renal tubular dysgenesis (RTD) [MIM:267430]: Autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). {ECO:0000269 PubMed:16116425}. Note=The disease is caused by variants affecting the gene represented in this entry.
  • Familial juvenile hyperuricemic nephropathy 2 (HNFJ2) [MIM:613092]: A renal disease characterized by juvenile onset of hyperuricemia, slowly progressive renal failure and anemia. {ECO:0000269 PubMed:19664745}. Note=The disease is caused by variants affecting the gene represented in this entry.

Additional Disease Information for REN

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with REN: view

No data available for Genatlas for REN Gene

Publications for REN Gene

  1. Mutations in genes in the renin-angiotensin system are associated with autosomal recessive renal tubular dysgenesis. (PMID: 16116425) Gribouval O … Gubler MC (Nature genetics 2005) 3 4 22 72
  2. Dominant renin gene mutations associated with early-onset hyperuricemia, anemia, and chronic kidney failure. (PMID: 19664745) Zivná M … Kmoch S (American journal of human genetics 2009) 3 4 72
  3. Analysis of renin-angiotensin aldosterone system gene polymorphisms in Malaysian essential hypertensive and type 2 diabetic subjects. (PMID: 19243623) Ramachandran V … Shamsudin N (Cardiovascular diabetology 2009) 3 22 40
  4. [Comparative genetic analysis of different forms of low-renin arterial hypertension]. (PMID: 18856058) Chikhladze NM … Favorova OO (Molekuliarnaia biologiia 2008) 3 22 40
  5. Association of renin-angiotensin system and natriuretic peptide receptor A gene polymorphisms with hypertension in a Hellenic population. (PMID: 19126660) Tsezou A … Triposkiadis F (Journal of the renin-angiotensin-aldosterone system : JRAAS 2008) 3 22 40

Products for REN Gene

Sources for REN Gene