RAF1 Gene (Protein Coding)

Raf-1 Proto-Oncogene, Serine/Threonine Kinase

GC03M012583
GIFtS:
54
This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to a... See more...

Aliases for RAF1 Gene

Aliases for RAF1 Gene

  • Raf-1 Proto-Oncogene, Serine/Threonine Kinase 2 3 5
  • Raf-1 2 3 4
  • RAF Proto-Oncogene Serine/Threonine-Protein Kinase 3 4
  • V-Raf-1 Murine Leukemia Viral Oncogene Homolog 1 2 3
  • C-Raf Proto-Oncogene, Serine/Threonine Kinase 2 3
  • Proto-Oncogene C-RAF 3 4
  • EC 2.7.11.1 4 50
  • C-Raf 2 3
  • CRAF 2 3
  • V-Raf-1 Murine Leukemia Viral Oncogene-Like Protein 1 3
  • Raf Proto-Oncogene Serine/Threonine Protein Kinase 3
  • Oncogene RAF1 3
  • EC 2.7.11 50
  • CMD1NN 3
  • RAF1 5
  • CRaf 4
  • NS5 3
  • RAF 4

External Ids for RAF1 Gene

Previous GeneCards Identifiers for RAF1 Gene

  • GC03M012554
  • GC03M012600
  • GC03M012559
  • GC03M012625

Summaries for RAF1 Gene

Entrez Gene Summary for RAF1 Gene

  • This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq, Jul 2008]

CIViC Summary for RAF1 Gene

GeneCards Summary for RAF1 Gene

RAF1 (Raf-1 Proto-Oncogene, Serine/Threonine Kinase) is a Protein Coding gene. Diseases associated with RAF1 include Noonan Syndrome 5 and Leopard Syndrome 2. Among its related pathways are RET signaling and G-protein signaling M-RAS regulation pathway. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is ARAF.

UniProtKB/Swiss-Prot Summary for RAF1 Gene

  • Serine/threonine-protein kinase that acts as a regulatory link between the membrane-associated Ras GTPases and the MAPK/ERK cascade, and this critical regulatory link functions as a switch determining cell fate decisions including proliferation, differentiation, apoptosis, survival and oncogenic transformation. RAF1 activation initiates a mitogen-activated protein kinase (MAPK) cascade that comprises a sequential phosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 and MAP2K2/MEK2) and the extracellular signal-regulated kinases (MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (on residues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at 'Ser-75'. Phosphorylates adenylyl cyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation. Phosphorylates PPP1R12A resulting in inhibition of the phosphatase activity. Phosphorylates TNNT2/cardiac muscle troponin T. Can promote NF-kB activation and inhibit signal transducers involved in motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2), proliferation and angiogenesis (RB1). Can protect cells from apoptosis also by translocating to the mitochondria where it binds BCL2 and displaces BAD/Bcl2-antagonist of cell death. Regulates Rho signaling and migration, and is required for normal wound healing. Plays a role in the oncogenic transformation of epithelial cells via repression of the TJ protein, occludin (OCLN) by inducing the up-regulation of a transcriptional repressor SNAI2/SLUG, which induces down-regulation of OCLN. Restricts caspase activation in response to selected stimuli, notably Fas stimulation, pathogen-mediated macrophage apoptosis, and erythroid differentiation.

Tocris Summary for RAF1 Gene

  • Raf kinases, a family of three serine/threonine kinases, are part of the Ras-MAPK signaling cascade and phosphorylate MEK. Upon growth factor stimulation, Raf-1 (c-Raf) is activated by GTP-bound Ras and recruited to the cell membrane. This activation process is tightly regulated.

Gene Wiki entry for RAF1 Gene

Additional gene information for RAF1 Gene

No data available for PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for RAF1 Gene

Genomics for RAF1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Download GeneHancer 2017 data
Promoters and enhancers for RAF1 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH03J012662 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 255.4 +0.9 924 4.4 SP1 ZNF207 MYC NCOR1 IKZF1 ZNF580 ZNF592 KLF9 POLR2A ZNF10 RAF1 lnc-MKRN2-4 MKRN2OS MKRN2 TAMM41 TSEN2 piR-32214-471
GH03J012646 Enhancer 1.4 FANTOM5 ENCODE dbSUPER 30.1 +16.0 16039 2.7 BCLAF1 ZNF207 ZNF600 CEBPA ATF3 YY1 BCL11A CEBPB FOXA1 TRIM22 piR-32214-471 RAF1 MKRN2 TAMM41 MKRN2OS TSEN2 CRIP1P1 SNODB814
GH03J012680 Enhancer 1 FANTOM5 ENCODE dbSUPER 21.6 -17.7 -17696 2 IKZF1 ZIC2 YY1 MAFF SP2 ELF1 PRDM10 SPI1 MYC POLR2A RAF1 MKRN2OS CAND2 HSALNG0024234 RF01016-010 TMEM40
GH03J012998 Promoter/Enhancer 1.8 FANTOM5 Ensembl ENCODE dbSUPER 12.8 -335.7 -335702 2.3 BCLAF1 NCOR1 MYC IKZF1 ZNF592 ZMYM3 CEBPA NONO CTCF REST HSALNG0024256 RAF1 IQSEC1 TSEN2 lnc-RPL32-2 RPL32
GH03J012696 Enhancer 0.6 Ensembl 12.9 -32.5 -32476 1.2 ZNF580 ZMYM3 CEBPA CEBPB TEAD3 CBX1 HDAC2 ZNF143 ZNF768 CEBPG MKRN2 CRIP1P1 RAF1 KRT18P17 CAND2 RF01016-010 HSALNG0024234 TMEM40
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around RAF1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for RAF1

Top Transcription factor binding sites by QIAGEN in the RAF1 gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • CREB
  • deltaCREB
  • STAT1
  • STAT3
  • STAT5A
  • TBP

Genomic Locations for RAF1 Gene

Latest Assembly
chr3:12,583,601-12,664,125
(GRCh38/hg38)
Size:
80,525 bases
Orientation:
Minus strand

Previous Assembly
chr3:12,625,100-12,705,616
(GRCh37/hg19 by Entrez Gene)
Size:
80,517 bases
Orientation:
Minus strand

chr3:12,625,100-12,705,725
(GRCh37/hg19 by Ensembl)
Size:
80,626 bases
Orientation:
Minus strand

Genomic View for RAF1 Gene

Genes around RAF1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RAF1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RAF1 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for RAF1 Gene

Proteins for RAF1 Gene

Products:

  1. Antibodies for research
  2. Protein products for research
  3. Assay products for research

  • Protein details for RAF1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P04049-RAF1_HUMAN
    Recommended name:
    RAF proto-oncogene serine/threonine-protein kinase
    Protein Accession:
    P04049
    Secondary Accessions:
    • B0LPH8
    • B2R5N3
    • Q15278
    • Q9UC20

    Protein attributes for RAF1 Gene

    Size:
    648 amino acids
    Molecular mass:
    73052 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Monomer. Homodimer. Heterodimerizes with BRAF and this heterodimer possesses a highly increased kinase activity compared to the respective homodimers or monomers (PubMed:16508002). Heterodimerization is mitogen-regulated and enhanced by 14-3-3 proteins (PubMed:16508002). MAPK1/ERK2 activation can induce a negative feedback that promotes the dissociation of the heterodimer (PubMed:16508002). Forms a multiprotein complex with Ras (M-Ras/MRAS), SHOC2 and protein phosphatase 1 (PPP1CA, PPP1CB and PPP1CC) (PubMed:16630891). Interacts with LZTR1 (PubMed:30368668). Interacts with Ras proteins; the interaction is antagonized by RIN1 (PubMed:11784866). Weakly interacts with RIT1. Interacts (via N-terminus) with RGS14 (via RBD domains); the interaction mediates the formation of a ternary complex with BRAF, a ternary complex inhibited by GNAI1 (By similarity). Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones CDC37, PPP5C, TSC1 and client protein TSC2, CDK4, AKT, RAF1 and NR3C1; this complex does not contain co-chaperones STIP1/HOP and PTGES3/p23 (PubMed:29127155). Interacts with STK3/MST2; the interaction inhibits its pro-apoptotic activity (PubMed:15618521). Interacts (when phosphorylated at Ser-259) with YWHAZ (unphosphorylated at 'Thr-232') (PubMed:9360956, PubMed:31024343). Interacts with MAP2K1/MEK1 and MAP2K2/MEK2 (By similarity). Interacts with MAP3K5/ASF1 (via N-terminus) and this interaction inhibits the proapoptotic function of MAP3K5/ASK1 (PubMed:11427728). Interacts with PAK1 (via kinase domain) (PubMed:11733498). The phosphorylated form interacts with PIN1 (By similarity). The Ser-338 and Ser-339 phosphorylated form (by PAK1) interacts with BCL2 (PubMed:15849194). Interacts with PEBP1/RKIP and this interaction is enhanced if RAF1 is phosphorylated on residues Ser-338, Ser-339, Tyr-340 and Tyr-341 (PubMed:18294816). Interacts with ADCY2, ADCY5, ADCY6, DGKH, RCAN1/DSCR1, PPP1R12A, PKB/AKT1, PPP2CA, PPP2R1B, SPRY2, SPRY4, CNKSR1/CNK1, KSR2 and PHB/prohibitin (PubMed:10801873, PubMed:11719507, PubMed:12717443, PubMed:15385642, PubMed:15935327, PubMed:19710016, PubMed:10576742). Interacts with ROCK2 (By similarity). In its active form, interacts with PRMT5 (PubMed:21917714). Interacts with FAM83B; displaces 14-3-3 proteins from RAF1 and activates RAF1 (PubMed:22886302). Interacts with PDE8A; the interaction promotes RAF1 activity (PubMed:23509299). Interacts with MFHAS1 (PubMed:23327923). Interacts with GLS (PubMed:22538822). Interacts with NEK10 and MAP2K1; the interaction is direct with NEK10 and required for ERK1/2-signaling pathway activation in response to UV irradiation (PubMed:20956560).

    Three dimensional structures from OCA and Proteopedia for RAF1 Gene

    Alternative splice isoforms for RAF1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RAF1 Gene

Protein Expression for RAF1 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for RAF1 Gene

P04049:
  • LYKNCPKA
  • GIVLYELM
  • GSVLWMA
  • NILLFMG
  • SPNNLSPTGWS
  • RLDWNTDA
  • SNGFGFK
  • EPSLHRAAHTEDI
  • WMAPEVI
  • CISPTIVQQFGYQRRASDDGK
  • RKTFLKLAFCDICQKFLLN
  • LWMAPEVIRMQD
  • TQEKNKIRPRGQRDSSYYWEIEASEV
  • TVKIGDFGLATVK
  • HSESASPSA
  • ARQTAQGMDYLHAK
  • LKVRGLQPECCAVFRL
  • ERPLFPQIL
  • LPNKQRTVV
  • RWSGSQQVEQ
  • FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPN
  • VPLTTHNF
  • SSPSSEGSLSQRQRSTSTPNVHMVS
  • ASEVMLS
  • TQWCEGSSLY
  • HINNRDQIIFMVGRGYASPDLS
  • GMSLHDCLMK
  • LPSLTMRR
  • WHGDVAVK
  • RSASEPSL
  • GFRCQTCGYKFH
  • KSNNIFLH

Post-translational modifications for RAF1 Gene

  • Phosphorylation at Thr-269, Ser-338, Tyr-341, Thr-491 and Ser-494 results in its activation. Phosphorylation at Ser-29, Ser-43, Ser-289, Ser-296, Ser-301 and Ser-642 by MAPK1/ERK2 results in its inactivation. Phosphorylation at Ser-259 induces the interaction with YWHAZ and inactivates kinase activity. Dephosphorylation of Ser-259 by the complex containing protein phosphatase 1, SHOC2 and M-Ras/MRAS relieves inactivation, leading to stimulate RAF1 activity. Phosphorylation at Ser-338 by PAK1 and PAK5 and Ser-339 by PAK1 is required for its mitochondrial localization. Phosphorylation at Ser-621 in response to growth factor treatment stabilizes the protein, possibly by preventing proteasomal degradation. Phosphorylation at Ser-289, Ser-296, Ser-301, Ser-338 and Ser-621 are somehow linked to the methylation potential of cells. Treatment of cells with HGF in the presence of the methylation inhibitor 5'-methylthioadenosine (MTA) results in increased phosphorylation at Ser-338 and Ser-621 and decreased phosphorylation at Ser-296, Ser-301 and Ser-338. Dephosphorylation at Ser-338 by PPP5C results in an activity decrease.
  • Methylated at Arg-563 in response to EGF treatment. This modification leads to destabilization of the protein, possibly through proteasomal degradation.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for RAF1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibodies for research

  • Abcam antibodies for RAF1

Domains & Families for RAF1 Gene

Gene Families for RAF1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • FDA approved drug targets
  • Predicted intracellular proteins

Protein Domains for RAF1 Gene

InterPro:
Blocks:
  • Protein kinase C, phorbol ester/diacylglycerol binding
  • Raf-like Ras-binding

Suggested Antigen Peptide Sequences for RAF1 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ57286, highly similar to RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (B4E0X2_HUMAN)
  • cDNA FLJ50355, highly similar to RAF proto-oncogene serine/threonine-protein kinase (EC 2.7.11.1) (B4E1N6_HUMAN)
  • Raf-1 (RAF1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P04049

UniProtKB/Swiss-Prot:

RAF1_HUMAN :
  • Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
Family:
  • Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
genes like me logo Genes that share domains with RAF1: view

Function for RAF1 Gene

Products:

  1. Animal Models for research
  2. CRISPR products for research
  3. miRNA products for research
  4. Inhibitory RNAs for research
  5. Clone products for research
  6. Cell Lines for research

Molecular function for RAF1 Gene

UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase that acts as a regulatory link between the membrane-associated Ras GTPases and the MAPK/ERK cascade, and this critical regulatory link functions as a switch determining cell fate decisions including proliferation, differentiation, apoptosis, survival and oncogenic transformation. RAF1 activation initiates a mitogen-activated protein kinase (MAPK) cascade that comprises a sequential phosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 and MAP2K2/MEK2) and the extracellular signal-regulated kinases (MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (on residues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at 'Ser-75'. Phosphorylates adenylyl cyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation. Phosphorylates PPP1R12A resulting in inhibition of the phosphatase activity. Phosphorylates TNNT2/cardiac muscle troponin T. Can promote NF-kB activation and inhibit signal transducers involved in motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2), proliferation and angiogenesis (RB1). Can protect cells from apoptosis also by translocating to the mitochondria where it binds BCL2 and displaces BAD/Bcl2-antagonist of cell death. Regulates Rho signaling and migration, and is required for normal wound healing. Plays a role in the oncogenic transformation of epithelial cells via repression of the TJ protein, occludin (OCLN) by inducing the up-regulation of a transcriptional repressor SNAI2/SLUG, which induces down-regulation of OCLN. Restricts caspase activation in response to selected stimuli, notably Fas stimulation, pathogen-mediated macrophage apoptosis, and erythroid differentiation.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Regulation is a highly complex process involving membrane recruitment, protein-protein interactions, dimerization, and phosphorylation/dephosphorylation events. Ras-GTP recruits RAF1 to the membrane, thereby promoting its activation. The inactive conformation of RAF1 is maintained by autoinhibitory interactions occurring between the N-terminal regulatory and the C-terminal catalytic domains and by the binding of a 14-3-3 protein that contacts two phosphorylation sites, Ser-259 and Ser-621. Upon mitogenic stimulation, Ras and PPP2R1A cooperate to release autoinhibition and the subsequent phosphorylation of activating sites: Ser-338, Tyr-341, Thr-491, and Ser-494, yields a fully active kinase. Through a negative feedback mechanism involving MAPK1/ERK2, RAF1 is phosphorylated on Ser-29, Ser-43, Ser-289, Ser-296, Ser-301 and Ser-642 by MAPK1/ERK2, which yields an inactive, desensitized kinase. The signaling-competent conformation of RAF1 is finally re-established by the coordinated action of PIN1, a prolyl isomerase that converts pSer and pThr residues from the cis to the trans conformation, which is preferentially recognized and dephosphorylated by PPP2R1A. Activated by homodimerization and heterodimerization (with BRAF). Also regulated through association with other proteins such as KSR2, CNKSR1/CNK1, PEBP1/RKIP, PHB/prohibitin and SPRY4. PEBP1/RKIP acts by dissociating RAF1 from its substrates MAP2K1/MEK1 and MAP2K2/MEK2. PHB/prohibitin facilitates the displacement of 14-3-3 from RAF1 by activated Ras, thereby promoting cell membrane localization and phosphorylation of RAF1 at the activating Ser-338. SPRY4 inhibits Ras-independent, but not Ras-dependent, activation of RAF1. CNKSR1/CNK1 regulates Src-mediated RAF1 activation.
GENATLAS Biochemistry:
murine sarcoma viral (v-raf-1) oncogene homolog 1 (mitogenic factor) interacting with TC21 for activation and translocation to plasma membrane

Enzyme Numbers (IUBMB) for RAF1 Gene

Phenotypes From GWAS Catalog for RAF1 Gene

Gene Ontology (GO) - Molecular Function for RAF1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA,IBA 21873635
GO:0004674 protein serine/threonine kinase activity IEA,IDA 19667065
GO:0004709 MAP kinase kinase kinase activity IEA --
GO:0005515 protein binding IPI 7644510
genes like me logo Genes that share ontologies with RAF1: view

Phenotypes for RAF1 Gene

MGI mutant phenotypes for RAF1:
inferred from 12 alleles
GenomeRNAi human phenotypes for RAF1:
genes like me logo Genes that share phenotypes with RAF1: view

Human Phenotype Ontology for RAF1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for RAF1 Gene

MGI Knock Outs for RAF1:
  • Raf1 Raf1<tm1Bacc>
  • Raf1 Raf1<tm1Ulb>
  • Raf1 Raf1<tm1b(EUCOMM)Wtsi>
  • Raf1 Raf1<tm2.1Bacc>

Animal Models for research

  • Taconic Biosciences Mouse Models for RAF1

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for RAF1

No data available for Transcription Factor Targets and HOMER Transcription for RAF1 Gene

Localization for RAF1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RAF1 Gene

Cytoplasm. Cell membrane. Mitochondrion. Nucleus. Note=Colocalizes with RGS14 and BRAF in both the cytoplasm and membranes. Phosphorylation at Ser-259 impairs its membrane accumulation. Recruited to the cell membrane by the active Ras protein. Phosphorylation at Ser-338 and Ser-339 by PAK1 is required for its mitochondrial localization. Retinoic acid-induced Ser-621 phosphorylated form of RAF1 is predominantly localized at the nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RAF1 gene
Compartment Confidence
plasma membrane 5
mitochondrion 5
nucleus 5
cytosol 5
golgi apparatus 4
cytoskeleton 3
extracellular 2
endoplasmic reticulum 2
endosome 2
lysosome 2
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nuclear speckles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for RAF1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IDA,ISS --
GO:0005739 mitochondrion IBA 21873635
GO:0005741 mitochondrial outer membrane TAS 8929532
GO:0005794 Golgi apparatus IPI 17724343
genes like me logo Genes that share ontologies with RAF1: view

Pathways & Interactions for RAF1 Gene

PathCards logo

SuperPathways for RAF1 Gene

SuperPathway Contained pathways
1 RET signaling
Frs2-mediated activation
.95
GRB2 events in EGFR signaling
.95
MAPK1/MAPK3 signaling
.95
Prolonged ERK activation events
.95
RAF/MAP kinase cascade
.95
SHC1 events in EGFR signaling
.95
Signaling by Leptin
.95
SOS-mediated signalling
.95
VEGFR2 mediated cell proliferation
.95
ARMS-mediated activation
.95
Signalling to ERKs
.95
Signalling to p38 via RIT and RIN
.95
Signalling to RAS
.95
Interleukin receptor SHC signaling
.95
Interleukin-3, 5 and GM-CSF signaling
.94
Interleukin-2 signaling
.94
Downstream signal transduction
.94
Signaling by PDGF
.94
DAP12 signaling
.92
RET signaling
.92
Insulin receptor signalling cascade
.92
Signaling by Insulin receptor
.92
IRS-mediated signalling
.91
Signaling by EGFR
.90
FCERI mediated MAPK activation
.90
IGF1R signaling cascade
.90
IRS-related events triggered by IGF1R
.90
Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R)
.90
DAP12 interactions
.89
NCAM signaling for neurite out-growth
.89
NGF signalling via TRKA from the plasma membrane
.87
MAPK family signaling cascades
.87
Signaling by SCF-KIT
.85
Signalling by NGF
.81
Fc epsilon receptor (FCERI) signaling
.79
VEGFA-VEGFR2 Pathway
.78
Signaling by VEGF
.76
Gastrin-CREB signalling pathway via PKC and MAPK
.55
2 IL-2 Pathway
ErbB Family Pathway
.59
ErbB4 Pathway
.59
Prolactin Signaling
.54
Thrombopoietin Pathway
.51
ErbB2-ErbB3 Heterodimers
.49
IL-2 Pathway
.48
LPS Stimulated MAPK Signaling
.47
UVC-Induced MAPK Signaling
.44
TREM1 Pathway
.43
PI3K Signaling in B-Lymphocyte
.35
IL-4 Pathway
.34
3 Regulation of lipid metabolism Insulin signaling-generic cascades
Regulation of lipid metabolism Insulin signaling-generic cascades
.59
Translation Insulin regulation of translation
.59
Transcription Receptor-mediated HIF regulation
.51
Translation Regulation of EIF2 activity
.47
Translation Regulation of EIF4F activity
.44
Development CNTF receptor signaling
.43
Cell adhesion PLAU signaling
.35
Development Growth hormone signaling via PI3K/AKT and MAPK cascades
.34
Insulin signaling pathway
.32
ErbB2/ErbB3 signaling events
.31
4 Common Cytokine Receptor Gamma-Chain Family Signaling Pathways
IL-21 Signaling Pathways
.90
IL-7 Signaling Pathways
.90
IL-9 Signaling Pathways
.90
Common Cytokine Receptor Gamma-Chain Family Signaling Pathways
.90
IL-15 Signaling Pathways
.88
IL-2 Signaling Pathways
.88
IL-4 Signaling Pathways
.84
Immune response IL-9 signaling pathway
.42
Development Thrombopoietin-regulated cell processes
.38
Adipokines and Insulin Signaling Pathways
.34
5 Endometrial cancer
Colorectal cancer
.50
Endometrial cancer
.50
Pancreatic cancer
.46
Chronic myeloid leukemia
.45
Signal transduction PTEN pathway
.44
Prostate cancer
.32
Acute myeloid leukemia
.30
genes like me logo Genes that share pathways with RAF1: view

Pathways by source for RAF1 Gene

89 GeneGo (Thomson Reuters) pathways for RAF1 Gene
  • Apoptosis and survival Anti-apoptotic action of membrane-bound ESR1
  • Apoptosis and survival BAD phosphorylation
  • Apoptosis and survival Role of CDK5 in neuronal death and survival
  • Apoptosis and survival_Anti-apoptotic action of nuclear ESR1 and ESR2
  • Apoptosis and survival_Regulation of Apoptosis by Mitochondrial Proteins
3 Tocris pathways for RAF1 Gene
99 Qiagen pathways for RAF1 Gene
  • 14-3-3 Induced Intracellular Signaling
  • Activation of cAMP-Dependent PKA
  • Activation of PKA through GPCR
  • Activation of PKC through GPCR
  • Akt Signaling
1 Cell Signaling Technology pathway for RAF1 Gene
1 GeneTex pathway for RAF1 Gene

SIGNOR curated interactions for RAF1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for RAF1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade TAS --
GO:0000186 activation of MAPKK activity IDA 10644344
GO:0001666 response to hypoxia IEA --
GO:0001678 cellular glucose homeostasis IEA --
GO:0001934 positive regulation of protein phosphorylation IEA --
genes like me logo Genes that share ontologies with RAF1: view

Drugs & Compounds for RAF1 Gene

Products:

  1. Drug products for research

(112) Drugs for RAF1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Sorafenib Approved, Investigational Pharma Target, inhibitor, inhibitors Raf kinases and tyrosine kinases inhibitor, RAF, VEGFR2, and PDGFR-beta inhibitors, Kinase Inhibitors, Vascular endothelial growth factor (VEGF) and VEGF receptor (VEGFR) inhibitors 801
regorafenib Approved Pharma Target, inhibitor Inhibitor of VEGFR/PDGFR/FGFR/mutant kit/RET/Raf-1, Kinase Inhibitors, Vascular endothelial growth factor (VEGF) and VEGF receptor (VEGFR) inhibitors 0
Cisplatin Approved Pharma Inhibits DNA synthesis,chemotherapy drug, Potent pro-apoptotic anticancer agent; activates caspase-3, Platinum 3624
Docetaxel Approved, Investigational Pharma Microtubulin disassembly inhibitor, Tubulin and VEGF inhibitor, Taxanes 2429
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 3989

(56) Additional Compounds for RAF1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ZM 336372
208260-29-1
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
 58-64-0
DG(16:0/24:0/0:0)
  • 1-Palmitoyl-2-lignoceroyl-sn-glycerol
  • DAG(16:0/24:0)
  • DAG(40:0)
  • DG(16:0/24:0)
  • DG(40:0)
Diglycerides Group A
  • (2R)-2-Hydroxy-3-(pentadecanoyloxy)propyl (11Z)-icos-11-enoic acid
  • Diacylglycerol(15:0/0:0/20:1)
  • DAG(35:1)
  • Diacylglycerol(35:1)
  • DG(15:0/0:0/20:1W9)
Diglycerides Group B
  • Diglyceride
  • DG(32:4)
  • DG(14:1/18:3)
  • DAG(14:1/18:3)
  • Diacylglycerol(32:4)
 257891-89-7

(4) Tocris Compounds for RAF1 Gene

Compound Action Cas Number
GW 5074 Potent, selective c-Raf1 kinase inhibitor 220904-83-6
KG 5 PDGFRbeta, B-Raf, c-Raf, FLT3 and KIT inhibitor 877874-85-6