Aliases for RAF1 Gene
Aliases for RAF1 Gene
- Raf-1 Proto-Oncogene, Serine/Threonine Kinase 2 3 5
- V-Raf-1 Murine Leukemia Viral Oncogene Homolog 1 2 3
- C-Raf Proto-Oncogene, Serine/Threonine Kinase 2 3
- Proto-Oncogene C-RAF 3 4
- EC 2.7.11.1 4 56
- Raf-1 3 4
- CRAF 3 4
- V-Raf-1 Murine Leukemia Viral Oncogene-Like Protein 1 3
- RAF Proto-Oncogene Serine/Threonine-Protein Kinase 3
External Ids for RAF1 Gene
- HGNC: 9829
- Entrez Gene: 5894
- Ensembl: ENSG00000132155
- OMIM: 164760
- UniProtKB: P04049
Previous GeneCards Identifiers for RAF1 Gene
- GC03M012554
- GC03M012600
- GC03M012559
- GC03M012625
Summaries for RAF1 Gene
-
This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq, Jul 2008]
GeneCards Summary for RAF1 Gene
RAF1 (Raf-1 Proto-Oncogene, Serine/Threonine Kinase) is a Protein Coding gene. Diseases associated with RAF1 include Noonan Syndrome 5 and Leopard Syndrome 2. Among its related pathways are G-protein signaling N-RAS regulation pathway and RET signaling. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is ARAF.
UniProtKB/Swiss-Prot for RAF1 Gene
-
Serine/threonine-protein kinase that acts as a regulatory link between the membrane-associated Ras GTPases and the MAPK/ERK cascade, and this critical regulatory link functions as a switch determining cell fate decisions including proliferation, differentiation, apoptosis, survival and oncogenic transformation. RAF1 activation initiates a mitogen-activated protein kinase (MAPK) cascade that comprises a sequential phosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 and MAP2K2/MEK2) and the extracellular signal-regulated kinases (MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (on residues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at Ser-75. Phosphorylates adenylyl cyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation. Phosphorylates PPP1R12A resulting in inhibition of the phosphatase activity. Phosphorylates TNNT2/cardiac muscle troponin T. Can promote NF-kB activation and inhibit signal transducers involved in motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2), proliferation and angiogenesis (RB1). Can protect cells from apoptosis also by translocating to the mitochondria where it binds BCL2 and displaces BAD/Bcl2-antagonist of cell death. Regulates Rho signaling and migration, and is required for normal wound healing. Plays a role in the oncogenic transformation of epithelial cells via repression of the TJ protein, occludin (OCLN) by inducing the up-regulation of a transcriptional repressor SNAI2/SLUG, which induces down-regulation of OCLN. Restricts caspase activation in response to selected stimuli, notably Fas stimulation, pathogen-mediated macrophage apoptosis, and erythroid differentiation.
-
Raf kinases, a family of three serine/threonine kinases, are part of the Ras-MAPK signaling cascade and phosphorylate MEK. Upon growth factor stimulation, Raf-1 (c-Raf) is activated by GTP-bound Ras and recruited to the cell membrane. This activation process is tightly regulated.
Additional gene information for RAF1 Gene
- Monarch Initiative
- Search for RAF1 at DataMed
- Search for RAF1 at HumanCyc
No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RAF1 Gene
Genomics for RAF1 Gene
GeneHancer (GH) Regulatory Elements for RAF1 Gene
Promoters and enhancers for RAF1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around RAF1 on UCSC Golden Path with GeneCards custom track
Regulatory Element Products
Genomic Locations for RAF1 Gene
Genomic Locations for RAF1 Gene
- chr3:12,583,601-12,664,226
- (GRCh38/hg38)
- Size:
- 80,626 bases
- Orientation:
- Minus strand
- chr3:12,625,100-12,705,725
- (GRCh37/hg19)
Genomic View for RAF1 Gene
Genes around RAF1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 3p25.2 by Ensembl
- 3p25.2 by Entrez Gene
- 3p25.2 by HGNC
RAF1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for RAF1 Gene
Proteins for RAF1 Gene
-
Protein details for RAF1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P04049-RAF1_HUMAN
- Recommended name:
- RAF proto-oncogene serine/threonine-protein kinase
- Protein Accession:
- P04049
- B0LPH8
- B2R5N3
- Q15278
- Q9UC20
Protein attributes for RAF1 Gene
- Size:
- 648 amino acids
- Molecular mass:
- 73052 Da
- Cofactor:
- Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Quaternary structure:
-
- Monomer. Homodimer. Heterodimerizes with BRAF and this heterodimer possesses a highly increased kinase activity compared to the respective homodimers or monomers (PubMed:16508002). Heterodimerization is mitogen-regulated and enhanced by 14-3-3 proteins (PubMed:16508002). MAPK1/ERK2 activation can induce a negative feedback that promotes the dissociation of the heterodimer (PubMed:16508002). Forms a multiprotein complex with Ras (M-Ras/MRAS), SHOC2 and protein phosphatase 1 (PPP1CA, PPP1CB and PPP1CC) (PubMed:16630891). Interacts with Ras proteins; the interaction is antagonized by RIN1 (PubMed:11784866). Weakly interacts with RIT1. Interacts (via N-terminus) with RGS14 (via RBD domains); the interaction mediates the formation of a ternary complex with BRAF, a ternary complex inhibited by GNAI1 (By similarity). Interacts with STK3/MST2; the interaction inhibits its pro-apoptotic activity (PubMed:15618521). Interacts (when phosphorylated at Ser-259) with YWHAZ (unphosphorylated at Thr-232) (PubMed:9360956). Interacts with MAP2K1/MEK1 and MAP2K2/MEK2 (By similarity). Interacts with MAP3K5/ASF1 (via N-terminus) and this interaction inhibits the proapoptotic function of MAP3K5/ASK1 (PubMed:11427728). Interacts with PAK1 (via kinase domain) (PubMed:11733498). The phosphorylated form interacts with PIN1 (By similarity). The Ser-338 and Ser-339 phosphorylated form (by PAK1) interacts with BCL2 (PubMed:15849194). Interacts with PEBP1/RKIP and this interaction is enhanced if RAF1 is phosphorylated on residues Ser-338, Ser-339, Tyr-340 and Tyr-341 (PubMed:18294816). Interacts with ADCY2, ADCY5, ADCY6, DGKH, RCAN1/DSCR1, PPP1R12A, PKB/AKT1, PPP2CA, PPP2R1B, SPRY2, SPRY4, CNKSR1/CNK1, KSR2 and PHB/prohibitin (PubMed:10801873, PubMed:11719507, PubMed:12717443, PubMed:15385642, PubMed:15935327, PubMed:19710016, PubMed:10576742). Interacts with ROCK2 (By similarity). In its active form, interacts with PRMT5 (PubMed:21917714). Interacts with FAM83B; displaces 14-3-3 proteins from RAF1 and activates RAF1 (PubMed:22886302). Interacts with PDE8A; the interaction promotes RAF1 activity (PubMed:23509299).
Three dimensional structures from OCA and Proteopedia for RAF1 Gene
Protein Expression for RAF1 Gene
Selected DME Specific Peptides for RAF1 Gene
- P04049:
-
- LYKNCPKA
- GIVLYELM
- GSVLWMA
- NILLFMG
- SPNNLSPTGWS
- RLDWNTDA
- SNGFGFK
- EPSLHRAAHTEDI
- WMAPEVI
- CISPTIVQQFGYQRRASDDGK
- RKTFLKLAFCDICQKFLLN
- LWMAPEVIRMQD
- TQEKNKIRPRGQRDSSYYWEIEASEV
- TVKIGDFGLATVK
- HSESASPSA
- ARQTAQGMDYLHAK
- LKVRGLQPECCAVFRL
- ERPLFPQIL
- LPNKQRTVV
- RWSGSQQVEQ
- FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPN
- VPLTTHNF
- SSPSSEGSLSQRQRSTSTPNVHMVS
- ASEVMLS
- TQWCEGSSLY
- HINNRDQIIFMVGRGYASPDLS
- GMSLHDCLMK
- LPSLTMRR
- WHGDVAVK
- RSASEPSL
- GFRCQTCGYKFH
- KSNNIFLH
Post-translational modifications for RAF1 Gene
- Methylated at Arg-563 in response to EGF treatment. This modification leads to destabilization of the protein, possibly through proteasomal degradation.
- Phosphorylation at Thr-269, Ser-338, Tyr-341, Thr-491 and Ser-494 results in its activation. Phosphorylation at Ser-29, Ser-43, Ser-289, Ser-296, Ser-301 and Ser-642 by MAPK1/ERK2 results in its inactivation. Phosphorylation at Ser-259 induces the interaction with YWHAZ and inactivates kinase activity. Dephosphorylation of Ser-259 by the complex containing protein phosphatase 1, SHOC2 and M-Ras/MRAS relieves inactivation, leading to stimulate RAF1 activity. Phosphorylation at Ser-338 by PAK1 and PAK5 and Ser-339 by PAK1 is required for its mitochondrial localization. Phosphorylation at Ser-621 in response to growth factor treatment stabilizes the protein, possibly by preventing proteasomal degradation. Phosphorylation at Ser-289, Ser-296, Ser-301, Ser-338 and Ser-621 are somehow linked to the methylation potential of cells. Treatment of cells with HGF in the presence of the methylation inhibitor 5-methylthioadenosine (MTA) results in increased phosphorylation at Ser-338 and Ser-621 and decreased phosphorylation at Ser-296, Ser-301 and Ser-338. Dephosphorylation at Ser-338 by PPP5C results in a activity decrease.
- Modification sites at PhosphoSitePlus
- Modification sites at neXtProt
Other Protein References for RAF1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for RAF1 (Raf-1)
-
Custom Antibody ServicesOriGene Antibodies for RAF1
- TA313060
- TA318606
- TA319697
- TA322937
- TA325786
- TA325787
- TA325788
- TA325789
- TA325790
- TA325791
- TA347803
- TA348430
- TA349287
- TA313058
- TA313057
- TA313056
- TA313055
- TA313052
- TA313051
- TA309228
- TA309227
- TA303679
- SM1489P
- DM1042
- AP55888PU-S
- AP55888PU-N
- AP55772PU-S
- AP55772PU-N
- AP55703PU-S
- AP55703PU-N
- AP21123PU-N
- AP20995PU-N
- AP20904PU-N
- AP20700PU-N
- AP20499PU-N
- AP20215PU-N
- AP20214PU-N
- AP14629PU-N
- AP12926PU-N
- AP12891PU-N
- AP12876PU-N
- AP12864PU-N
- AP12862PU-N
- AP12801PU-N
- AP12797PU-N
- AP12786PU-N
- AP12784PU-N
- AP12748PU-N
- AP09462PU-S
- AP09462PU-N
- AP08058PU-S
- AP08058PU-N
- AP06438PU-N
- AP06299PU-N
- AP02550PU-S
- AP02550PU-N
- AP02308PU-S
- AP02308PU-N
- AP01674PU-N
- AP00222PU-N
- AP00041PU-N
- AM09323PU-N
- AM09322PU-N
- AM09321PU-N
- AM06729PU-N
- AM00132PU-N
- AM00131PU-N
- Novus Biologicals Antibodies for RAF1
-
Abcam antibodies for RAF1
-
Cloud-Clone Corp. Antibodies for RAF1
- Invitrogen Antibodies for RAF1
- antibodies-online: Search results for 864 available RAF1 Antibodies ranked by validation data
- Compare Top RAF1 Antibodies
-
Recommended
- 1 DB Antibody (anti-rat)
- 3 IHC (p) Antibodies (anti-rat)
- 5 IHC Antibodies (anti-rat)
- 132 IF (p) Antibodies (anti-rat)
- 235 WB Antibodies (anti-rat)
- 1 DB Antibody (anti-mouse)
- 6 IHC (p) Antibodies (anti-mouse)
- 6 IHC Antibodies (anti-mouse)
- 132 IF (p) Antibodies (anti-mouse)
- 257 WB Antibodies (anti-mouse)
- 3 FACS Antibodies (anti-human)
- 8 IHC Antibodies (anti-human)
- 9 EIA Antibodies (anti-human)
- 10 IHC (p) Antibodies (anti-human)
- 29 DB Antibodies (anti-human)
- 144 IF (p) Antibodies (anti-human)
- 486 WB Antibodies (anti-human)
- 1 DB Antibody (anti-rat)
- 3 IHC (p) Antibodies (anti-rat)
- 5 IHC Antibodies (anti-rat)
- 132 IF (p) Antibodies (anti-rat)
- 235 WB Antibodies (anti-rat)
- 1 DB Antibody (anti-mouse)
- 6 IHC (p) Antibodies (anti-mouse)
- 6 IHC Antibodies (anti-mouse)
- 132 IF (p) Antibodies (anti-mouse)
- 257 WB Antibodies (anti-mouse)
- 3 FACS Antibodies (anti-human)
- 8 IHC Antibodies (anti-human)
- 9 EIA Antibodies (anti-human)
- 10 IHC (p) Antibodies (anti-human)
- 29 DB Antibodies (anti-human)
- 144 IF (p) Antibodies (anti-human)
- 486 WB Antibodies (anti-human)
- 1 DB Antibody (anti-rat)
- 3 IHC (p) Antibodies (anti-rat)
- 5 IHC Antibodies (anti-rat)
- 132 IF (p) Antibodies (anti-rat)
- 235 WB Antibodies (anti-rat)
- 1 DB Antibody (anti-mouse)
- 6 IHC (p) Antibodies (anti-mouse)
- 6 IHC Antibodies (anti-mouse)
- 132 IF (p) Antibodies (anti-mouse)
- 257 WB Antibodies (anti-mouse)
- 3 FACS Antibodies (anti-human)
- 8 IHC Antibodies (anti-human)
- 9 EIA Antibodies (anti-human)
- 10 IHC (p) Antibodies (anti-human)
- 29 DB Antibodies (anti-human)
- 144 IF (p) Antibodies (anti-human)
- 486 WB Antibodies (anti-human)
- GeneTex RAF1 antibody for RAF1
-
Custom Antibody ServicesProSci Antibodies for RAF1
-
Santa Cruz Biotechnology (SCBT) Antibodies for RAF1
- Sino Biological Antibodies for RAF1
Protein Products
- R&D Systems Proteins and Enzymes for RAF1 (Raf-1)
-
OriGene Purified Proteins for RAF1
- Search Origene for MassSpec and Protein Over-expression Lysates for RAF1
- Origene Custom Protein Services for RAF1
-
Cloud-Clone Corp. Proteins for RAF1
- GeneTex Proteins for RAF1
-
Abcam proteins for RAF1
Assay Products
-
Cloud-Clone Corp. Assay Kits for RAF1
- antibodies-online: Search results for 25 available RAF1 Elisa Kits ranked by validation data
- Compare Top RAF1 Elisa Kits
-
Recommended
- 18 Rat (Rattus) ELISA Kits
- 18 Mouse (Murine) ELISA Kits
- 20 Human ELISA Kits
- 1 Cow (Bovine) ELISA Kit
- 1 Chicken ELISA Kit
- 18 Rat (Rattus) ELISA Kits
- 18 Mouse (Murine) ELISA Kits
- 20 Human ELISA Kits
- 1 Cow (Bovine) ELISA Kit
- 1 Chicken ELISA Kit
- 18 Rat (Rattus) ELISA Kits
- 18 Mouse (Murine) ELISA Kits
- 20 Human ELISA Kits
- 1 Cow (Bovine) ELISA Kit
- 1 Chicken ELISA Kit
-
Abcam assays for RAF1
Domains & Families for RAF1 Gene
Gene Families for RAF1 Gene
- HGNC:
- IUPHAR :
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Disease related genes
- Enzymes
- FDA approved drug targets
- Predicted intracellular proteins
Protein Domains for RAF1 Gene
Suggested Antigen Peptide Sequences for RAF1 Gene
Graphical View of Domain Structure for InterPro Entry
P04049UniProtKB/Swiss-Prot:
RAF1_HUMAN :- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
- Family:
-
- Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
Function for RAF1 Gene
Molecular function for RAF1 Gene
- GENATLAS Biochemistry:
- murine sarcoma viral (v-raf-1) oncogene homolog 1 (mitogenic factor) interacting with TC21 for activation and translocation to plasma membrane
- UniProtKB/Swiss-Prot CatalyticActivity:
- ATP + a protein = ADP + a phosphoprotein.
- UniProtKB/Swiss-Prot EnzymeRegulation:
- Regulation is a highly complex process involving membrane recruitment, protein-protein interactions, dimerization, and phosphorylation/dephosphorylation events. Ras-GTP recruits RAF1 to the membrane, thereby promoting its activation. The inactive conformation of RAF1 is maintained by autoinhibitory interactions occurring between the N-terminal regulatory and the C-terminal catalytic domains and by the binding of a 14-3-3 protein that contacts two phosphorylation sites, Ser-259 and Ser-621. Upon mitogenic stimulation, Ras and PPP2R1A cooperate to release autoinhibition and the subsequent phosphorylation of activating sites: Ser-338, Tyr-341, Thr-491, and Ser-494, yields a fully active kinase. Through a negative feedback mechanism involving MAPK1/ERK2, RAF1 is phosphorylated on Ser-29, Ser-43, Ser-289, Ser-296, Ser-301 and Ser-642 by MAPK1/ERK2, which yields an inactive, desensitized kinase. The signaling-competent conformation of RAF1 is finally re-established by the coordinated action of PIN1, a prolyl isomerase that converts pSer and pThr residues from the cis to the trans conformation, which is preferentially recognized and dephosphorylated by PPP2R1A. Activated by homodimerization and heterodimerization (with BRAF). Also regulated through association with other proteins such as KSR2, CNKSR1/CNK1, PEBP1/RKIP, PHB/prohibitin and SPRY4. PEBP1/RKIP acts by dissociating RAF1 from its substrates MAP2K1/MEK1 and MAP2K2/MEK2. PHB/prohibitin facilitates the displacement of 14-3-3 from RAF1 by activated Ras, thereby promoting cell membrane localization and phosphorylation of RAF1 at the activating Ser-338. SPRY4 inhibits Ras-independent, but not Ras-dependent, activation of RAF1. CNKSR1/CNK1 regulates Src-mediated RAF1 activation.
- UniProtKB/Swiss-Prot Function:
- Serine/threonine-protein kinase that acts as a regulatory link between the membrane-associated Ras GTPases and the MAPK/ERK cascade, and this critical regulatory link functions as a switch determining cell fate decisions including proliferation, differentiation, apoptosis, survival and oncogenic transformation. RAF1 activation initiates a mitogen-activated protein kinase (MAPK) cascade that comprises a sequential phosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 and MAP2K2/MEK2) and the extracellular signal-regulated kinases (MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (on residues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at Ser-75. Phosphorylates adenylyl cyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation. Phosphorylates PPP1R12A resulting in inhibition of the phosphatase activity. Phosphorylates TNNT2/cardiac muscle troponin T. Can promote NF-kB activation and inhibit signal transducers involved in motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2), proliferation and angiogenesis (RB1). Can protect cells from apoptosis also by translocating to the mitochondria where it binds BCL2 and displaces BAD/Bcl2-antagonist of cell death. Regulates Rho signaling and migration, and is required for normal wound healing. Plays a role in the oncogenic transformation of epithelial cells via repression of the TJ protein, occludin (OCLN) by inducing the up-regulation of a transcriptional repressor SNAI2/SLUG, which induces down-regulation of OCLN. Restricts caspase activation in response to selected stimuli, notably Fas stimulation, pathogen-mediated macrophage apoptosis, and erythroid differentiation.
Enzyme Numbers (IUBMB) for RAF1 Gene
Phenotypes From GWAS Catalog for RAF1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0004672 | protein kinase activity | IEA,TAS | 8063729 |
| GO:0004674 | protein serine/threonine kinase activity | IEA,IDA | 19667065 |
| GO:0004709 | MAP kinase kinase kinase activity | IBA | -- |
| GO:0005057 | signal transducer activity, downstream of receptor | IEA | -- |
Phenotypes for RAF1 Gene
- MGI mutant phenotypes for RAF1:
-
inferred from 12 alleles
- nervous system phenotype
- normal phenotype
- homeostasis/metabolism phenotype
- respiratory system phenotype
- muscle phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- cellular phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- neoplasm
- endocrine/exocrine gland phenotype
- vision/eye phenotype
- hearing/vestibular/ear phenotype
- integument phenotype
- embryo phenotype
- hematopoietic system phenotype
- skeleton phenotype
- liver/biliary system phenotype
- craniofacial phenotype
- no phenotypic analysis
- GenomeRNAi human phenotypes for RAF1:
-
- Increased vaccinia virus (VACV) infection
- shRNA abundance <= 50%
- Decreased shRNA abundance (Z-score < -2)
- Decreased JFH-1 genotype 2a Hepatitis C virus (HCV) infection
- Increased transferrin (TF) endocytosis
- Increased shRNA abundance (Z-score > 2)
- Decreased viability
- Decreased substrate adherent cell growth
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased cell death HMECs cells
- Decreased JFH-1 genotype 2a Hepatitis C virus (HCV) infection after viral supernatant infection
- Decreased JFH-1 genotype 2a Hepatitis C virus (HCV) infection after direct virus infection
- Decreased human cytomegalovirus (HCMV) strain AD169 replication
- Increased mitotic index
- Decreased IL-13 protein expression
- Increased senescence-associated beta-galactosidase protein expression after pRB stimulation
- Increased simian virus 40 (SV40) infection
- Decreased viability after Chlamydia trachomatis serovar L2 infection and TNF-alpha/CHX stimulation
Animal Models for RAF1 Gene
Animal Model Products
-
Taconic Biosciences Mouse Models for RAF1
- Cyagen custom Knockout/knockin (KOKI) mouse models for RAF1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for RAF1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for RAF1 gene
- Search ViGene Biosciences for RAF1
CRISPR Products
-
OriGene CRISPR knockouts for RAF1
- genomics-online: gRNA clones - Search results for 124 available RAF1 gene related products
- Overview of 124 available RAF1 gene related products
-
Recommended
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- Applied Biological Materials CRISPR for RAF1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for RAF1
- GenScript: Design CRISPR guide RNA sequences for RAF1
miRNA for RAF1 Gene
- miRTarBase miRNAs that target RAF1
-
- hsa-mir-7-5p (MIRT004026)
- hsa-mir-125b-5p (MIRT004418)
- hsa-mir-195-5p (MIRT006077)
- hsa-mir-497-5p (MIRT006078)
- hsa-mir-186-5p (MIRT044977)
- hsa-mir-23b-3p (MIRT046343)
- hsa-mir-16-5p (MIRT053089)
- hsa-mir-4799-5p (MIRT532154)
- hsa-mir-6881-3p (MIRT532155)
- hsa-mir-6780a-3p (MIRT532156)
- hsa-mir-6516-3p (MIRT532157)
- hsa-mir-7111-3p (MIRT532158)
- hsa-mir-3682-5p (MIRT532159)
- hsa-mir-520f-5p (MIRT532160)
- hsa-mir-4291 (MIRT541099)
- hsa-mir-6789-5p (MIRT541100)
- hsa-mir-6077 (MIRT541101)
- hsa-mir-486-3p (MIRT541102)
- hsa-mir-4254 (MIRT541103)
- hsa-mir-4660 (MIRT541104)
- hsa-mir-3690 (MIRT541105)
- hsa-mir-6736-3p (MIRT541106)
- hsa-mir-7157-5p (MIRT541107)
- hsa-mir-4310 (MIRT541108)
- hsa-mir-6813-5p (MIRT541109)
- hsa-mir-6085 (MIRT541110)
- hsa-mir-6743-5p (MIRT541111)
- hsa-mir-4688 (MIRT541112)
- hsa-mir-3134 (MIRT542736)
- hsa-mir-8082 (MIRT542737)
- hsa-mir-4534 (MIRT542738)
- hsa-mir-19b-3p (MIRT726794)
- hsa-mir-19a-3p (MIRT726795)
- hsa-mir-132-3p (MIRT731714)
- hsa-mir-7-1-3p (MIRT733010)
- hsa-mir-125a-5p (MIRT734728)
miRNA Products
- Search ViGene Biosciences for RAF1
Inhibitory RNA Products
- Origene shrna, sirna, and RNAi products in human, mouse, rat for RAF1
- Browse OriGene Inhibitory RNA Products For RAF1
- genomics-online: shRNA clones - Search results for 124 available RAF1 gene related products
- Overview of 124 available RAF1 gene related products
-
Recommended
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
-
ViGene Biosciences ready-to-package AAV shRNAs for RAF1 gene
Clone Products
- Sino Biological Human cDNA Clone for RAF1
- VectorBuilder custom plasmid, inducible vectors for RAF1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for RAF1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for RAF1
- genomics-online: cdna clones - Search results for 124 available RAF1 gene related products
- Overview of 124 available RAF1 gene related products
-
Recommended
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- orf clones - Search results for 124 available RAF1 gene related products
- Overview of 124 available RAF1 gene related products
-
Recommended
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- pGFP-C-shLenti
- pRFP-C-RS
- pGFP-V-RS
- pPB-His-GST
- pPB-N-His
- pPB-C-His
- pPB-His-MBP
- pCMV6-XL5
- pLenti-C-mGFP
- pLenti-C-Myc-DDK
- pCMV6-AC
- pCMV6-Entry
- pCMV6-XL4
- Applied Biological Materials Clones for RAF1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for RAF1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for RAF1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for RAF1 gene
No data available for Transcription Factor Targets and HOMER Transcription for RAF1 Gene
Localization for RAF1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for RAF1 Gene
- Cytoplasm. Cell membrane. Mitochondrion. Nucleus. Note=Colocalizes with RGS14 and BRAF in both the cytoplasm and membranes. Phosphorylation at Ser-259 impairs its membrane accumulation. Recruited to the cell membrane by the active Ras protein. Phosphorylation at Ser-338 and Ser-339 by PAK1 is required for its mitochondrial localization. Retinoic acid-induced Ser-621 phosphorylated form of RAF1 is predominantly localized at the nucleus.
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| mitochondrion | 5 |
| nucleus | 5 |
| cytosol | 5 |
| golgi apparatus | 4 |
| extracellular | 2 |
| cytoskeleton | 1 |
| endoplasmic reticulum | 1 |
- Nuclear speckles (2)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005622 | intracellular | IEA | -- |
| GO:0005634 | nucleus | IEA | -- |
| GO:0005737 | cytoplasm | IDA,ISS | -- |
| GO:0005739 | mitochondrion | IEA | -- |
| GO:0005741 | mitochondrial outer membrane | TAS | 8929532 |
Pathways & Interactions for RAF1 Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | RET signaling |
.92
|
.92
|
| 2 | IL-2 Pathway |
.59
.48
|
.43
.34
|
| 3 | Endometrial cancer |
.52
.47
|
.32
|
| 4 | Regulation of lipid metabolism Insulin signaling-generic cascades | ||
| 5 | Common Cytokine Receptor Gamma-Chain Family Signaling Pathways | ||
Pathways by source for RAF1 Gene
10 Sino Biological pathways for RAF1 Gene
1 GeneTex pathway for RAF1 Gene
68 BioSystems pathways for RAF1 Gene
74 Reactome pathways for RAF1 Gene
4 PharmGKB pathways for RAF1 Gene
70 KEGG pathways for RAF1 Gene
89 GeneGo (Thomson Reuters) pathways for RAF1 Gene
- Apoptosis and survival Anti-apoptotic action of membrane-bound ESR1
- Apoptosis and survival BAD phosphorylation
- Apoptosis and survival Role of CDK5 in neuronal death and survival
- Apoptosis and survival_Anti-apoptotic action of nuclear ESR1 and ESR2
- Apoptosis and survival_Regulation of Apoptosis by Mitochondrial Proteins
14 R&D Systems pathways for RAF1 Gene
3 Tocris pathways for RAF1 Gene
99 Qiagen pathways for RAF1 Gene
1 Cell Signaling Technology pathway for RAF1 Gene
Interacting Proteins for RAF1 Gene
Selected Interacting proteins:
P04049-RAF1_HUMAN
ENSP00000251849
for RAF1 Gene via
MINT
STRING
UniProtKB
IID
SIGNOR curated interactions for RAF1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000165 | MAPK cascade | TAS | -- |
| GO:0000186 | activation of MAPKK activity | IDA | 10644344 |
| GO:0001666 | response to hypoxia | IEA | -- |
| GO:0001678 | cellular glucose homeostasis | IEA | -- |
| GO:0001934 | positive regulation of protein phosphorylation | IEA | -- |
Drugs & Compounds for RAF1 Gene
(116) Drugs for RAF1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, FDA Approved Drugs, HMDB, Tocris, and Novoseek
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Sorafenib | Approved, Investigational | Pharma | Target, inhibitor, inhibitors | Raf kinases and tyrosine kinases inhibitor, RAF, VEGFR2, and PDGFR-beta inhibitors, Kinase Inhibitors, Vascular endothelial growth factor (VEGF) and VEGF receptor (VEGFR) inhibitors | 717 | |
| regorafenib | Approved | Pharma | Target, inhibitor | Inhibitor of VEGFR/PDGFR/FGFR/mutant kit/RET/Raf-1, Kinase Inhibitors, Vascular endothelial growth factor (VEGF) and VEGF receptor (VEGFR) inhibitors | 0 | |
| Cisplatin | Approved | Pharma | Inhibits DNA synthesis,chemotherapy drug, Potent pro-apoptotic anticancer agent; activates caspase-3, Platinum | 2906 | ||
| Docetaxel | Approved May 1996, Investigational | Pharma | Microtubulin disassembly inhibitor, Tubulin and VEGF inhibitor, Taxanes | 2040 | ||
| Paclitaxel | Approved, Vet_approved | Pharma | Tubulin and Bcl2 inhibitor, Taxanes | 3027 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| ZM 336372 |
|
208260-29-1 |
|
|||
| ADP |
|
Full agonist, Agonist | 58-64-0 |
|
||
| Diglycerides Group A |
|
|
||||
| Diglycerides Group B |
|
|
||||
| Diglycerides Group C |
|
|
|
(4) Tocris Compounds for RAF1 Gene
(23) ApexBio Compounds for RAF1 Gene
| Compound | Action | Cas Number |
|---|---|---|
| AZ 628 | Raf kinases,potent and ATP-competitive | 878739-06-1 |
| B-Raf IN 1 | 950736-05-7 | |
| B-Raf inhibitor 1 | 1093100-40-3 | |
| CEP-32496 | BRAF(V600E)inhibitor,highly potent | 1188910-76-0 |