This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may b... See more...

Aliases for PTK2 Gene

Aliases for PTK2 Gene

  • Protein Tyrosine Kinase 2 2 3 5
  • Protein Phosphatase 1 Regulatory Subunit 71 3 4
  • Focal Adhesion Kinase-Related Nonkinase 3 4
  • PTK2 Protein Tyrosine Kinase 2 2 3
  • Focal Adhesion Kinase 1 3 4
  • EC 2.7.10.2 4 54
  • Pp125FAK 3 4
  • PPP1R71 3 4
  • P125FAK 3 4
  • FADK 1 3 4
  • FAK1 3 4
  • FRNK 3 4
  • FAK 3 4
  • Protein Phosphatase 1, Regulatory Subunit 71 2
  • Focal Adhesion Kinase Isoform FAK-Del33 3
  • FAK-Related Non-Kinase Polypeptide 3
  • Protein-Tyrosine Kinase 2 4
  • EC 2.7.10 54
  • FADK 3

External Ids for PTK2 Gene

Previous GeneCards Identifiers for PTK2 Gene

  • GC08M140557
  • GC08M141856
  • GC08M141352
  • GC08M141639
  • GC08M141737
  • GC08M136979
  • GC08M141667

Summaries for PTK2 Gene

Entrez Gene Summary for PTK2 Gene

  • This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]

GeneCards Summary for PTK2 Gene

PTK2 (Protein Tyrosine Kinase 2) is a Protein Coding gene. Diseases associated with PTK2 include Glioblastoma Multiforme and Ovarian Cancer. Among its related pathways are MAPK-Erk Pathway and Overview of nanoparticle effects. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is PTK2B.

UniProtKB/Swiss-Prot Summary for PTK2 Gene

  • Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.

Tocris Summary for PTK2 Gene

  • Focal adhesion kinase (FAK), a non-receptor tyrosine kinase, is the first intracellular step in the signal transduction cascade initiated by the attachment of an integrin to the extracellular matrix at points known as focal adhesions. FAK has a key role in cellular migration and motility.

Gene Wiki entry for PTK2 Gene

Additional gene information for PTK2 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PTK2 Gene

Genomics for PTK2 Gene

GeneHancer (GH) Regulatory Elements for PTK2 Gene

Promoters and enhancers for PTK2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH08J140998 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 756.9 +0.9 899 4.9 SIN3A ZBTB40 CTCF RBPJ SMARCE1 POLR2A ZNF362 ETV6 ELF1 HLF PTK2 lnc-DENND3-6 lnc-PTK2-7 CHRAC1 AGO2 RF00994-1098 RF00017-7353
GH08J140763 Promoter/Enhancer 1.3 EPDnew Ensembl ENCODE dbSUPER 762.4 +237.5 237528 2.2 CREM CREB1 PKNOX1 ZEB2 ATF7 RUNX3 FOS JUNB JUN BATF PTK2 lnc-AGO2-5 MIR151A AGO2 CHRAC1 piR-41306-264
GH08J141005 Promoter/Enhancer 0.5 Ensembl dbSUPER 750.6 -1.9 -1885 0.2 PTK2 lnc-PTK2-7 piR-32286-015 RF00017-7353
GH08J140456 Promoter/Enhancer 2.4 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 19.6 +543.5 543466 4.9 ZNF785 ZNF24 ZBTB40 SP1 ZBTB6 FOXA1 RBPJ SMARCE1 POLR2A CTBP1 TRAPPC9 CHRAC1 AGO2 PTK2 KCNK9 ENSG00000259891 lnc-CHRAC1-1 RF00017-7343
GH08J140506 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 10.9 +491.8 491807 7.5 E2F8 ZNF24 ZBTB40 SP1 SIX5 ZBTB6 RBPJ SMARCE1 POLR2A CTBP1 CHRAC1 KCNK9 PTK2 ENSG00000259891 RF00017-7343
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PTK2 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PTK2 gene promoter:
  • AP-1
  • CREB
  • deltaCREB
  • SRF
  • SRF (504 AA)

Genomic Locations for PTK2 Gene

Genomic Locations for PTK2 Gene
chr8:140,657,900-141,002,216
(GRCh38/hg38)
Size:
344,317 bases
Orientation:
Minus strand
chr8:141,667,999-142,012,315
(GRCh37/hg19)
Size:
344,317 bases
Orientation:
Minus strand

Genomic View for PTK2 Gene

Genes around PTK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PTK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PTK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PTK2 Gene

Proteins for PTK2 Gene

  • Protein details for PTK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q05397-FAK1_HUMAN
    Recommended name:
    Focal adhesion kinase 1
    Protein Accession:
    Q05397
    Secondary Accessions:
    • B4E2N6
    • F5H4S4
    • J3QT16
    • Q14291
    • Q8IYN9
    • Q9UD85

    Protein attributes for PTK2 Gene

    Size:
    1052 amino acids
    Molecular mass:
    119233 Da
    Quaternary structure:
    • Interacts (via first Pro-rich region) with CAS family members (via SH3 domain), including BCAR1, BCAR3, CASS4 and NEDD9. Interacts with GIT1. Interacts with SORBS1. Interacts with ARHGEF28. Interacts with SHB. Interacts with PXN and TLN1. Interacts with STAT1. Interacts with DCC. Interacts with WASL. Interacts with ARHGEF7. Interacts with GRB2 and GRB7 (By similarity). Component of a complex that contains at least FER, CTTN and PTK2/FAK1. Interacts with BMX. Interacts with TGFB1I1. Interacts with STEAP4. Interacts with ZFYVE21. Interacts with ESR1. Interacts with PIK3R1 or PIK3R2. Interacts with SRC, FGR, FLT4 and RET. Interacts with EPHA2 in resting cells; activation of EPHA2 recruits PTPN11, leading to dephosphorylation of PTK2/FAK1 and dissociation of the complex. Interacts with EPHA1 (kinase activity-dependent). Interacts with CD4; this interaction requires the presence of HIV-1 gp120. Interacts with PIAS1. Interacts with ARHGAP26 and SHC1. Interacts with RB1CC1; this inhibits PTK2/FAK1 activity and activation of downstream signaling pathways. Interacts with P53/TP53 and MDM2. Interacts with LPXN (via LD motif 3). Interacts with MISP. Interacts with CIB1 isoform 2. Interacts with CD36. Interacts with EMP2; regulates PTK2 activation and localization (PubMed:19494199). Interacts with DSCAM (By similarity).

    Three dimensional structures from OCA and Proteopedia for PTK2 Gene

    Alternative splice isoforms for PTK2 Gene

neXtProt entry for PTK2 Gene

Selected DME Specific Peptides for PTK2 Gene

Q05397:
  • SEEVHWLH
  • HPPEEWKYELRIRYLPKGF
  • GVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKC
  • VCMWEIL
  • DKECFKCALGSSWIISVELAIGPEEGISYLTDKG
  • GNQHIYQPVGKPD
  • SEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDG
  • QQEERMRMESRRQ
  • APPKKPPRPGAP
  • AARNVLV
  • NQFTEDKPTLNFFYQQVK
  • PESINFRRFT
  • AVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGV
  • CVKLGDFGLSRY
  • IQPAPPEEYVPMVK
  • ETDDYAEIIDEEDTYTMPS
  • NDKVYENVTGLVKAVIEMSS
  • IRHGDATDVRGIIQKIVDSHKVK
  • QVQTIQYS
  • EMRGNALEKKSNYEVLEKDVGL
  • LPASTHREIEMAQKLLNSDL
  • AENMADLIDGYCRL
  • TVSWDSGGSDEAPPKPSRPGYPSPRSSEGF
  • PTANLDR

Post-translational modifications for PTK2 Gene

  • Phosphorylated on tyrosine residues upon activation, e.g. upon integrin signaling. Tyr-397 is the major autophosphorylation site, but other kinases can also phosphorylate this residue. Phosphorylation at Tyr-397 promotes interaction with SRC and SRC family members, leading to phosphorylation at Tyr-576, Tyr-577 and at additional tyrosine residues. FGR promotes phosphorylation at Tyr-397 and Tyr-576. FER promotes phosphorylation at Tyr-577, Tyr-861 and Tyr-925, even when cells are not adherent. Tyr-397, Tyr-576 and Ser-722 are phosphorylated only when cells are adherent. Phosphorylation at Tyr-397 is important for interaction with BMX, PIK3R1 and SHC1. Phosphorylation at Tyr-925 is important for interaction with GRB2. Dephosphorylated by PTPN11; PTPN11 is recruited to PTK2 via EPHA2 (tyrosine phosphorylated). Microtubule-induced dephosphorylation at Tyr-397 is crucial for the induction of focal adhesion disassembly; this dephosphorylation could be catalyzed by PTPN11 and regulated by ZFYVE21. Phosphorylation on tyrosine residues is enhanced by NTN1 (By similarity).
  • Sumoylated; this enhances autophosphorylation.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for PTK2 Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

  • Abcam antibodies for PTK2

Domains & Families for PTK2 Gene

Gene Families for PTK2 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for PTK2 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ57218, highly similar to Focal adhesion kinase 1 (EC 2.7.10.2) (B4DWJ1_HUMAN)
  • pp125FAK (FAK1_HUMAN)
  • cDNA FLJ37680 fis, clone BRHIP2012923, highly similar to FOCAL ADHESION KINASE 1 (EC 2.7.1.112) (Q8N9D7_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q05397

UniProtKB/Swiss-Prot:

FAK1_HUMAN :
  • The Pro-rich regions interact with the SH3 domain of CAS family members, such as BCAR1 and NEDD9, and with the GTPase activating protein ARHGAP26.
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily.
Domain:
  • The Pro-rich regions interact with the SH3 domain of CAS family members, such as BCAR1 and NEDD9, and with the GTPase activating protein ARHGAP26.
  • The carboxy-terminal region is the site of focal adhesion targeting (FAT) sequence which mediates the localization of FAK1 to focal adhesions.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family. FAK subfamily.
genes like me logo Genes that share domains with PTK2: view

Function for PTK2 Gene

Molecular function for PTK2 Gene

UniProtKB/Swiss-Prot Function:
Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]; Xref=Rhea:RHEA:10596, Rhea:RHEA-COMP:10136, Rhea:RHEA-COMP:10137, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:46858, ChEBI:CHEBI:82620, ChEBI:CHEBI:456216; EC=2.7.10.2; Evidence={ECO:0000255 PROSITE-ProRule:PRU10028, ECO:0000269 PubMed:10655584, ECO:0000269 PubMed:11331870, ECO:0000269 PubMed:18339875};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Subject to autoinhibition, mediated by interactions between the FERM domain and the kinase domain. Activated by autophosphorylation at Tyr-397. This promotes interaction with SRC and phosphorylation at Tyr-576 and Tyr-577 in the kinase activation loop. Phosphorylation at Tyr-576 and Tyr-577 is required for maximal kinase activity. Inhibited by TAC544, TAE226, PF-573,228 and PF-562,271.
GENATLAS Biochemistry:
focal adhesion kinase 1,pp125FAK,widely expressed in T and B lymphocytes,with a splice variant,FAK1A,expressed in brain,primary mediator of integrin signaling after integrin mediated cell adhesion and FAK phosphorylation,also mediating a direct interaction with the C terminal SH2 domain of phospholipase C (PCLG1)

Enzyme Numbers (IUBMB) for PTK2 Gene

Phenotypes From GWAS Catalog for PTK2 Gene

Gene Ontology (GO) - Molecular Function for PTK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0003779 actin binding IDA 16803572
GO:0004672 protein kinase activity TAS --
GO:0004713 protein tyrosine kinase activity TAS --
GO:0004715 non-membrane spanning protein tyrosine kinase activity IBA,IDA 10655584
genes like me logo Genes that share ontologies with PTK2: view
genes like me logo Genes that share phenotypes with PTK2: view

Animal Models for PTK2 Gene

MGI Knock Outs for PTK2:
  • Ptk2 Ptk2<tm1Imeg>
  • Ptk2 Ptk2<tm1.2Guan>
  • Ptk2 Ptk2<tm1.1Jtpa>
  • Ptk2 Ptk2<tm1Ilic>

Animal Model Products

  • Taconic Biosciences Mouse Models for PTK2

CRISPR Products

Clone Products

  • Addgene plasmids for PTK2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PTK2 Gene

Localization for PTK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PTK2 Gene

Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Note=Constituent of focal adhesions. Detected at microtubules.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PTK2 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 5
nucleus 5
cytosol 5
extracellular 3
mitochondrion 1
endoplasmic reticulum 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Focal adhesion sites (3)
  • Vesicles (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PTK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001725 stress fiber IDA 24036928
GO:0005634 nucleus IDA,IEA 15855171
GO:0005737 cytoplasm IEA,IDA 21637765
GO:0005815 microtubule organizing center IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with PTK2: view

Pathways & Interactions for PTK2 Gene

PathCards logo

SuperPathways for PTK2 Gene

SuperPathway Contained pathways
1 RET signaling
2 ERK Signaling
.61
.61
.58
.51
.49
3 Integrin Pathway
.67
.67
.56
.56
.38
4 Focal Adhesion
.33
5 EPH-Ephrin signaling
genes like me logo Genes that share pathways with PTK2: view

Pathways by source for PTK2 Gene

SIGNOR curated interactions for PTK2 Gene

Gene Ontology (GO) - Biological Process for PTK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade TAS --
GO:0000226 microtubule cytoskeleton organization IEA --
GO:0001525 angiogenesis IBA,TAS 20552554
GO:0001568 blood vessel development IEA --
GO:0001570 vasculogenesis IEA --
genes like me logo Genes that share ontologies with PTK2: view

Drugs & Compounds for PTK2 Gene

(97) Drugs for PTK2 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
2-({5-CHLORO-2-[(2-METHOXY-4-MORPHOLIN-4-YLPHENYL)AMINO]PYRIMIDIN-4-YL}AMINO)-N-METHYLBENZAMIDE Experimental Pharma Target 0
7-PYRIDIN-2-YL-N-(3,4,5-TRIMETHOXYPHENYL)-7H-PYRROLO[2,3-D]PYRIMIDIN-2-AMINE Experimental Pharma Target 0
Genistein Investigational Pharma Potentiation, Activator, Agonist AR agonist, EGFR kinase inhibitor. Also estrogen and PPARgamma ligand 57
Endostatin Investigational Pharma Target 0

(60) Additional Compounds for PTK2 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Full agonist, Agonist, Partial agonist, Antagonist, Gating inhibitor 58-64-0
LysoPA(0:0/16:0)
  • 2-palmitoyl-glycero-3-phosphate
  • LPA(0:0/16:0)
  • Lysophosphatidic Acid(0:0/16:0)
  • LPA(16:0)
  • 2-hexadecanoyl-phosphatidic acid
LysoPA(0:0/18:0)
  • LPA(0:0/18:0)
  • LPA(18:0)
  • Lysophosphatidic Acid(0:0/18:0)
  • Lysophosphatidic Acid(18:0)
  • 2-stearoyl-glycero-3-phosphate
LysoPA(0:0/18:1(9Z))
  • Lysophosphatidic Acid(18:1)
  • LPA(0:0/18:1(9Z))
  • LPA(0:0/18:1)
  • Lysophosphatidic Acid(0:0/18:1)
  • 2-oleoyl-glycero-3-phosphate
LysoPA(0:0/18:2(9Z,12Z))
  • {3-hydroxy-2-[(9Z,12Z)-octadeca-9,12-dienoyloxy]propoxy}phosphonate
  • LPA(18:2)
  • LPA(0:0/18:2(9Z,12Z))
  • 2-(9Z,12Z-octadecadienoyl)-phosphatidic acid
  • Lysophosphatidic Acid(18:2)

(4) Tocris Compounds for PTK2 Gene

Compound Action Cas Number
FAK Inhibitor 14 Selective FAK inhibitor 4506-66-5
PF 431396 Dual FAK/PYK2 inhibitor 717906-29-1
PF 573228 Potent and selective FAK inhibitor 869288-64-2
Y 11 Potent and selective FAK inhibitor 1086639-59-9

(12) ApexBio Compounds for PTK2 Gene

Compound Action Cas Number
CEP-37440 FAK/ALK inhibitor,potent and selective 1391712-60-9
Defactinib 1073154-85-4
FAK Inhibitor 14 4506-66-5
Genistein AR agonist 446-72-0
PF-00562271 FAK/Pyk2 inhibitor,potent and ATP-competitive 939791-38-5
PF-431396 Pyk2 and FAK inhibitor 717906-29-1
PF-562271 ATP-competitive FAK inhibitor, reversible 717907-75-0
PF-562271 HCl FAK/Pyk2 inhibitor
PF-573228 ATP-competitive FAK inhibitor 869288-64-2
PND-1186 Potent FAK inhibitor 1061353-68-1
TAE226 (NVP-TAE226) FAK inhibitor,potent and ATP-competitive 761437-28-9
Y 11 1086639-59-9
genes like me logo Genes that share compounds with PTK2: view

Transcripts for PTK2 Gene

CRISPR Products

Clone Products

  • Addgene plasmids for PTK2

Alternative Splicing Database (ASD) splice patterns (SP) for PTK2 Gene

ExUns: 1 ^ 2a · 2b · 2c ^ 3 ^ 4 ^ 5 ^ 6a · 6b · 6c ^ 7a · 7b · 7c · 7d ^ 8 ^ 9a · 9b ^ 10a · 10b · 10c · 10d ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^
SP1: - - - - - - - - - - -
SP2: - -
SP3:
SP4:
SP5:
SP6:
SP7: - - - - - - -
SP8: - - -
SP9: - - - - -
SP10:
SP11:
SP12: - - - - - - - - - - - -
SP13: - - -
SP14: - - - - - - - - - - -
SP15:
SP16:
SP17: - -
SP18:
SP19:
SP20:
SP21:
SP22: -

ExUns: 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21a · 21b ^ 22 ^ 23 ^ 24 ^ 25a · 25b ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31a · 31b ^ 32 ^ 33a · 33b ^ 34a · 34b ^ 35 ^ 36a ·
SP1: - - - - - -
SP2: - - - - - - - -
SP3: - - - - - -
SP4: - - - - -
SP5: -
SP6: - - -
SP7:
SP8:
SP9:
SP10: -
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18: - -
SP19:
SP20:
SP21:
SP22:

ExUns: 36b ^ 37 ^ 38a · 38b · 38c ^ 39 ^ 40 ^ 41 ^ 42a · 42b · 42c
SP1: - - -
SP2: - - -
SP3: - - -
SP4: - - -
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15: