This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gen... See more...

Aliases for PTGES3 Gene

Aliases for PTGES3 Gene

  • Prostaglandin E Synthase 3 2 3 4 5
  • Prostaglandin E Synthase 3 (Cytosolic) 2 3
  • Cytosolic Prostaglandin E2 Synthase 3 4
  • Progesterone Receptor Complex P23 3 4
  • Telomerase-Binding Protein P23 3 4
  • Hsp90 Co-Chaperone 3 4
  • EC 5.3.99.3 4 52
  • CPGES 3 4
  • TEBP 3 4
  • P23 3 4
  • Unactive Progesterone Receptor, 23 KD 3
  • Cytosolic Prostaglandin E Synthase 3

External Ids for PTGES3 Gene

Previous GeneCards Identifiers for PTGES3 Gene

  • GC12M055344
  • GC12M057057
  • GC12M054096

Summaries for PTGES3 Gene

Entrez Gene Summary for PTGES3 Gene

  • This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. [provided by RefSeq, Feb 2016]

GeneCards Summary for PTGES3 Gene

PTGES3 (Prostaglandin E Synthase 3) is a Protein Coding gene. Diseases associated with PTGES3 include Primary Hypertrophic Osteoarthropathy. Among its related pathways are Cytochrome P450 - arranged by substrate type and Arachidonic acid metabolism. Gene Ontology (GO) annotations related to this gene include unfolded protein binding and prostaglandin-E synthase activity. An important paralog of this gene is PTGES3L.

UniProtKB/Swiss-Prot Summary for PTGES3 Gene

  • Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) (PubMed:10922363). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes (PubMed:11274138, PubMed:12077419). Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway (PubMed:24711448).

Gene Wiki entry for PTGES3 Gene

Additional gene information for PTGES3 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PTGES3 Gene

Genomics for PTGES3 Gene

GeneHancer (GH) Regulatory Elements for PTGES3 Gene

Promoters and enhancers for PTGES3 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PTGES3 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PTGES3

Top Transcription factor binding sites by QIAGEN in the PTGES3 gene promoter:
  • Arnt
  • ARP-1
  • C/EBPalpha
  • CHOP-10
  • COMP1
  • HOXA5
  • MAZR
  • MIF-1
  • NF-kappaB
  • NF-kappaB1

Genomic Locations for PTGES3 Gene

Genomic Locations for PTGES3 Gene
chr12:56,663,341-56,688,408
(GRCh38/hg38)
Size:
25,068 bases
Orientation:
Minus strand
chr12:57,057,125-57,082,159
(GRCh37/hg19)
Size:
25,035 bases
Orientation:
Minus strand

Genomic View for PTGES3 Gene

Genes around PTGES3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PTGES3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PTGES3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PTGES3 Gene

Proteins for PTGES3 Gene

  • Protein details for PTGES3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q15185-TEBP_HUMAN
    Recommended name:
    Prostaglandin E synthase 3
    Protein Accession:
    Q15185
    Secondary Accessions:
    • A8K7D0
    • B4DHP2
    • B4DP11
    • B4DP21
    • Q8WU70

    Protein attributes for PTGES3 Gene

    Size:
    160 amino acids
    Molecular mass:
    18697 Da
    Quaternary structure:
    • Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2 (PubMed:29127155). Binds to the progesterone receptor (PubMed:8114727). Interacts with TERT; the interaction, together with HSP90AA1, is required for correct assembly and stabilization of the telomerase holoenzyme complex (PubMed:11274138). Interacts (via PXLE motif) with EGLN1/PHD2, recruiting EGLN1/PHD2 to the HSP90 pathway to facilitate HIF alpha proteins hydroxylation (PubMed:24711448). Interacts with HSP90AA1, FLCN, FNIP1 and FNIP2 (PubMed:27353360).

    Three dimensional structures from OCA and Proteopedia for PTGES3 Gene

    Alternative splice isoforms for PTGES3 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PTGES3 Gene

Selected DME Specific Peptides for PTGES3 Gene

Q15185:
  • DVDLPEVDGADDDS
  • SKHKRTDRSILCCLRKGESGQ
  • WPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFS

Post-translational modifications for PTGES3 Gene

  • Ubiquitination at Lys7, Lys48, Lys79, and Lys95
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Abcam antibodies for PTGES3

Domains & Families for PTGES3 Gene

Gene Families for PTGES3 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for PTGES3 Gene

InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for PTGES3 Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ40895 fis, clone UTERU2002294, highly similar to Prostaglandin E synthase 3 (EC 5.3.99.3) (B3KUY2_HUMAN)
  • cDNA FLJ59832, moderately similar to Prostaglandin E synthase 3 (EC 5.3.99.3) (B4DDC6_HUMAN)
  • cDNA FLJ59888, moderately similar to Prostaglandin E synthase 3 (EC 5.3.99.3) (B4DHP2_HUMAN)
  • cDNA FLJ59942, highly similar to Prostaglandin E synthase 3 (EC 5.3.99.3) (B4DP11_HUMAN)
  • cDNA FLJ50819, highly similar to Prostaglandin E synthase 3 (EC 5.3.99.3) (B4DP21_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q15185

UniProtKB/Swiss-Prot:

TEBP_HUMAN :
  • The PXLE motif mediates interaction with EGLN1/PHD2.
  • Belongs to the p23/wos2 family.
Domain:
  • The PXLE motif mediates interaction with EGLN1/PHD2.
Family:
  • Belongs to the p23/wos2 family.
genes like me logo Genes that share domains with PTGES3: view

Function for PTGES3 Gene

Molecular function for PTGES3 Gene

UniProtKB/Swiss-Prot Function:
Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) (PubMed:10922363). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes (PubMed:11274138, PubMed:12077419). Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway (PubMed:24711448).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=prostaglandin H2 = prostaglandin E2; Xref=Rhea:RHEA:12893, ChEBI:CHEBI:57405, ChEBI:CHEBI:606564; EC=5.3.99.3; Evidence=. ;.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=14 uM for PGH2 {ECO:0000269 PubMed:10922363}; Vmax=190 nmol/min/mg enzyme toward PGH2 {ECO:0000269 PubMed:10922363};

Enzyme Numbers (IUBMB) for PTGES3 Gene

Phenotypes From GWAS Catalog for PTGES3 Gene

Gene Ontology (GO) - Molecular Function for PTGES3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003720 telomerase activity IDA 12135483
GO:0005515 protein binding IPI 9817749
GO:0016853 isomerase activity IEA --
GO:0050220 prostaglandin-E synthase activity IBA,IDA 10922363
GO:0051082 unfolded protein binding IDA 12077419
genes like me logo Genes that share ontologies with PTGES3: view
genes like me logo Genes that share phenotypes with PTGES3: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PTGES3

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PTGES3 Gene

Localization for PTGES3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PTGES3 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PTGES3 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 2
extracellular 2
cytoskeleton 2
mitochondrion 2
endoplasmic reticulum 2
peroxisome 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PTGES3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000781 chromosome, telomeric region IC 12135483
GO:0005634 nucleus IBA 21873635
GO:0005654 nucleoplasm IDA,TAS --
GO:0005697 telomerase holoenzyme complex IDA 12135483
GO:0005737 cytoplasm IBA 21873635
genes like me logo Genes that share ontologies with PTGES3: view

Pathways & Interactions for PTGES3 Gene

genes like me logo Genes that share pathways with PTGES3: view

Pathways by source for PTGES3 Gene

2 KEGG pathways for PTGES3 Gene
1 GeneGo (Thomson Reuters) pathway for PTGES3 Gene
  • Development_Glucocorticoid receptor signaling

UniProtKB/Swiss-Prot Q15185-TEBP_HUMAN

  • Pathway: Lipid metabolism; prostaglandin biosynthesis.

SIGNOR curated interactions for PTGES3 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for PTGES3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000723 telomere maintenance TAS 12135483
GO:0001516 prostaglandin biosynthetic process IEA,IDA 10922363
GO:0005978 glycogen biosynthetic process IEA --
GO:0006457 protein folding IBA 21873635
GO:0006629 lipid metabolic process IEA --
genes like me logo Genes that share ontologies with PTGES3: view

Drugs & Compounds for PTGES3 Gene

(15) Drugs for PTGES3 Gene - From: DrugBank, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Progesterone Approved, Vet_approved Pharma Full agonist, Activator, Agonist, Inhibition, Pore Blocker Endogenous progesterone receptor agonist 721
Acetaminophen Approved Pharma Target, inhibitor 1285
Copper Approved, Investigational Pharma Target 236
Flurbiprofen Approved, Investigational Pharma Channel blocker 70
Suprofen Approved, Withdrawn Pharma 0

(6) Additional Compounds for PTGES3 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Prostaglandin H2
  • (5Z,13E)-(15S)-9alpha,11alpha-Epidioxy-15-hydroxyprosta-5,13-dienoate
  • (5Z,13E,15S)-9alpha,11alpha-Epidioxy-15-hydroxyprosta-5,13-dienoate
  • (5Z,9alpha,11alpha,13E,15S)-9,11-Epidioxy-15-hydroxyprosta-5,13-dien-1-Oic acid
  • 9,11-epoxymethano-PGH2
  • PGH2
42935-17-1

(3) ApexBio Compounds for PTGES3 Gene

Compound Action Cas Number
Flurbiprofen 5104-49-4
Mesalamine 89-57-6
Suprofen 40828-46-4
genes like me logo Genes that share compounds with PTGES3: view

Transcripts for PTGES3 Gene

mRNA/cDNA for PTGES3 Gene

6 REFSEQ mRNAs :
18 NCBI additional mRNA sequence :
7 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PTGES3

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PTGES3 Gene

ExUns: 1a · 1b · 1c ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7 ^ 8
SP1: - - - -
SP2: - - - - -
SP3: - - - -
SP4: - -
SP5: -

Relevant External Links for PTGES3 Gene

GeneLoc Exon Structure for
PTGES3

Expression for PTGES3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PTGES3 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PTGES3 Gene

This gene is overexpressed in Tlymphocyte (6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PTGES3 Gene



Protein tissue co-expression partners for PTGES3 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PTGES3

SOURCE GeneReport for Unigene cluster for PTGES3 Gene:

Hs.50425

Evidence on tissue expression from TISSUES for PTGES3 Gene

  • Nervous system(5)
  • Lung(4.8)
  • Liver(4.7)
  • Blood(4.4)
  • Intestine(4.2)
  • Pancreas(3.8)
  • Eye(3.3)
  • Skin(3.3)
  • Kidney(3.2)
  • Stomach(2.7)
  • Muscle(2.3)
  • Heart(2.1)
genes like me logo Genes that share expression patterns with PTGES3: view

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PTGES3 Gene

Orthologs for PTGES3 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PTGES3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PTGES3 31 30
  • 100 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Ptges3 31
  • 99 (a)
OneToOne
Gm9769 30
  • 94.97 (n)
Ptges3-ps 17
dog
(Canis familiaris)
Mammalia PTGES3 31 30
  • 98.54 (n)
OneToOne
cow
(Bos Taurus)
Mammalia PTGES3 31 30
  • 97.69 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Ptges3 30
  • 95.18 (n)
oppossum
(Monodelphis domestica)
Mammalia PTGES3 31
  • 86 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PTGES3 31
  • 71 (a)
OneToOne
chicken
(Gallus gallus)
Aves PTGES3 30
  • 90.15 (n)
lizard
(Anolis carolinensis)
Reptilia PTGES3 31
  • 94 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ptges3 30
  • 84.91 (n)
African clawed frog
(Xenopus laevis)
Amphibia tebp-pending-prov 30
zebrafish
(Danio rerio)
Actinopterygii ptges3a 31 30
  • 77.28 (n)
OneToMany
ptges3b 31 31
  • 75 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea ZC395.10 31
  • 25 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes -- 31
  • 4 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.10501 31
  • 27 (a)
ManyToMany
Species where no ortholog for PTGES3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PTGES3 Gene

ENSEMBL:
Gene Tree for PTGES3 (if available)
TreeFam:
Gene Tree for PTGES3 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PTGES3: view image

Paralogs for PTGES3 Gene

Paralogs for PTGES3 Gene

(2) SIMAP similar genes for PTGES3 Gene using alignment to 6 proteins:

  • TEBP_HUMAN
  • B3KUY2_HUMAN
  • B4DDC6_HUMAN
  • B4DHP2_HUMAN
  • B4DP11_HUMAN
  • B4DP21_HUMAN
genes like me logo Genes that share paralogs with PTGES3: