The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiq... See more...

Aliases for PSMB1 Gene

Aliases for PSMB1 Gene

  • Proteasome 20S Subunit Beta 1 2 3 5
  • Proteasome (Prosome, Macropain) Subunit, Beta Type, 1 2 3
  • Multicatalytic Endopeptidase Complex Subunit C5 3 4
  • Proteasome Subunit Beta Type-1 3 4
  • Proteasome Subunit Beta 1 2 3
  • Proteasome Component C5 3 4
  • Proteasome Gamma Chain 3 4
  • Macropain Subunit C5 3 4
  • PMSB1 2 3
  • PSC5 3 4
  • HC5 2 3
  • Testicular Secretory Protein Li 45 3
  • Proteasome Beta 1 Subunit 3
  • Proteasome Subunit Beta6 3
  • Proteasome Subunit HC5 3
  • Proteasome Subunit Β6 2
  • EC 3.4.25.1 51
  • PSMB1 5

External Ids for PSMB1 Gene

Previous GeneCards Identifiers for PSMB1 Gene

  • GC06M170039
  • GC06M170459
  • GC06M170700
  • GC06M170761
  • GC06M168349
  • GC06M170844

Summaries for PSMB1 Gene

Entrez Gene Summary for PSMB1 Gene

  • The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species. [provided by RefSeq, Jul 2008]

GeneCards Summary for PSMB1 Gene

PSMB1 (Proteasome 20S Subunit Beta 1) is a Protein Coding gene. Diseases associated with PSMB1 include Type 1 Diabetes Mellitus 8 and Anterior Segment Dysgenesis 3. Among its related pathways are Downstream signaling events of B Cell Receptor (BCR) and CDK-mediated phosphorylation and removal of Cdc6. Gene Ontology (GO) annotations related to this gene include threonine-type endopeptidase activity. An important paralog of this gene is PSMB11.

UniProtKB/Swiss-Prot Summary for PSMB1 Gene

  • Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Gene Wiki entry for PSMB1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PSMB1 Gene

Genomics for PSMB1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PSMB1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PSMB1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PSMB1

Top Transcription factor binding sites by QIAGEN in the PSMB1 gene promoter:
  • CUTL1
  • E2F
  • E2F-1
  • E2F-2
  • E2F-3a
  • E2F-4
  • E2F-5
  • RelA
  • TBP

Genomic Locations for PSMB1 Gene

Latest Assembly
chr6:170,535,120-170,553,307
(GRCh38/hg38)
Size:
18,188 bases
Orientation:
Minus strand

Previous Assembly
chr6:170,844,208-170,862,395
(GRCh37/hg19 by Entrez Gene)
Size:
18,188 bases
Orientation:
Minus strand

chr6:170,844,205-170,862,429
(GRCh37/hg19 by Ensembl)
Size:
18,225 bases
Orientation:
Minus strand

Genomic View for PSMB1 Gene

Genes around PSMB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PSMB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PSMB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PSMB1 Gene

Proteins for PSMB1 Gene

  • Protein details for PSMB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P20618-PSB1_HUMAN
    Recommended name:
    Proteasome subunit beta type-1
    Protein Accession:
    P20618
    Secondary Accessions:
    • B5BU76
    • Q9BWA8

    Protein attributes for PSMB1 Gene

    Size:
    241 amino acids
    Molecular mass:
    26489 Da
    Quaternary structure:
    • The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is a barrel-shaped complex made of 28 subunits that are arranged in four stacked rings. The two outer rings are each formed by seven alpha subunits, and the two inner rings are formed by seven beta subunits. The proteolytic activity is exerted by three beta-subunits PSMB5, PSMB6 and PSMB7. Interacts with SERPINB2. Interacts with RFPL4A (By similarity).
    • (Microbial infection) Interacts with HIV-1 protein Tat.

    Three dimensional structures from OCA and Proteopedia for PSMB1 Gene

neXtProt entry for PSMB1 Gene

Selected DME Specific Peptides for PSMB1 Gene

P20618:
  • VASDTRLSEG
  • TVIGCSGFHGDCLTLTKIIEARLKMYKHSNNK
  • LAIAGEDF
  • RDSPKCYKLTD
  • KAGGSASAMLQPLLDNQ
  • YSFDPVGSY
  • GAIAAMLSTILY
  • FISAAERD

Post-translational modifications for PSMB1 Gene

  • Glycosylation at Ser58 and Ser209
  • Ubiquitination at Lys77, Lys94, Lys164, Lys184, Lys204, and Lys228
  • Modification sites at PhosphoSitePlus

Other Protein References for PSMB1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibodies for research

  • Boster Bio Antibodies for PSMB1

Domains & Families for PSMB1 Gene

Gene Families for PSMB1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for PSMB1 Gene

InterPro:
Blocks:
  • Proteasome B-type subunit
ProtoNet:

Suggested Antigen Peptide Sequences for PSMB1 Gene

GenScript: Design optimal peptide antigens:
  • Proteasome gamma chain (PSB1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P20618

UniProtKB/Swiss-Prot:

PSB1_HUMAN :
  • Belongs to the peptidase T1B family.
Family:
  • Belongs to the peptidase T1B family.
genes like me logo Genes that share domains with PSMB1: view

Function for PSMB1 Gene

Molecular function for PSMB1 Gene

UniProtKB/Swiss-Prot Function:
Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).
GENATLAS Biochemistry:
multicatalytic proteinase complex (20S) proteasome (prosome,macropain) component,beta type 1,subunit HC5,26kDa

Enzyme Numbers (IUBMB) for PSMB1 Gene

Phenotypes From GWAS Catalog for PSMB1 Gene

Gene Ontology (GO) - Molecular Function for PSMB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004175 endopeptidase activity IBA 21873635
GO:0004298 threonine-type endopeptidase activity IEA --
GO:0005515 protein binding IPI 12376572
GO:0008233 peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with PSMB1: view
genes like me logo Genes that share phenotypes with PSMB1: view

miRNA for PSMB1 Gene

miRTarBase miRNAs that target PSMB1

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PSMB1

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PSMB1 Gene

Localization for PSMB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PSMB1 Gene

Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PSMB1 gene
Compartment Confidence
nucleus 5
cytosol 5
extracellular 4
cytoskeleton 3
plasma membrane 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PSMB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000502 proteasome complex TAS,IDA 17323924
GO:0005576 extracellular region TAS --
GO:0005634 nucleus IBA 21873635
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IBA 21873635
genes like me logo Genes that share ontologies with PSMB1: view

Pathways & Interactions for PSMB1 Gene

PathCards logo

SuperPathways for PSMB1 Gene

SuperPathway Contained pathways
1 CDK-mediated phosphorylation and removal of Cdc6
.78
.31
2 RET signaling
3 Chks in Checkpoint Regulation
.59
.59
.55
.43
.32
.31
4 HIV Life Cycle
.45
5 Pathways of neurodegeneration - multiple diseases
genes like me logo Genes that share pathways with PSMB1: view

Pathways by source for PSMB1 Gene

4 GeneGo (Thomson Reuters) pathways for PSMB1 Gene
  • Immune response Antigen presentation by MHC class I
  • Regulation of degradation of deltaF508 CFTR in CF
  • Regulation of degradation of wt-CFTR
  • Transcription Ligand-Dependent Transcription of Retinoid-Target genes
17 Qiagen pathways for PSMB1 Gene
  • CDK5 Pathway
  • Chks in Checkpoint Regulation
  • DNA Repair Mechanisms
  • Estrogen-mediated S-Phase Entry
  • G2-M Phase Transition

Gene Ontology (GO) - Biological Process for PSMB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade TAS --
GO:0000209 protein polyubiquitination TAS --
GO:0002223 stimulatory C-type lectin receptor signaling pathway TAS --
GO:0002479 antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent TAS --
GO:0006508 proteolysis IEA --
genes like me logo Genes that share ontologies with PSMB1: view

No data available for SIGNOR curated interactions for PSMB1 Gene

Drugs & Compounds for PSMB1 Gene

(5) Drugs for PSMB1 Gene - From: DrugBank and DGIdb

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Bortezomib Approved, Investigational Pharma Target, inhibitor, other Proteosome and NF-kappaB inhibitor, Other, Proteasome inhibitors 926
carfilzomib Approved, Investigational Pharma Target, inhibitor, other Other, 20S Proteasome Inhibitor 0
(3AR,6R,6AS)-6-((S)-((S)-CYCLOHEX-2-ENYL)(HYDROXY)METHYL)-6A-METHYL-4-OXO-HEXAHYDRO-2H-FURO[3,2-C]PYRROLE-6-CARBALDEHYDE Experimental Pharma Target 0
Oprozomib Investigational Pharma 0
MLN-9708 Pharma 0
genes like me logo Genes that share compounds with PSMB1: view

Transcripts for PSMB1 Gene

mRNA/cDNA for PSMB1 Gene

1 REFSEQ mRNAs :
13 NCBI additional mRNA sequence :
2 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PSMB1

Alternative Splicing Database (ASD) splice patterns (SP) for PSMB1 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5 ^ 6 ^ 7a · 7b · 7c
SP1: - -
SP2: - - -
SP3: - - -
SP4:
SP5:

Relevant External Links for PSMB1 Gene

GeneLoc Exon Structure for
PSMB1

Expression for PSMB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PSMB1 Gene

Protein differential expression in normal tissues from HIPED for PSMB1 Gene

This gene is overexpressed in Liver, secretome (7.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PSMB1 Gene



Protein tissue co-expression partners for PSMB1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PSMB1

SOURCE GeneReport for Unigene cluster for PSMB1 Gene:

Hs.352768

Evidence on tissue expression from TISSUES for PSMB1 Gene

  • Nervous system(4.9)
  • Lung(4.8)
  • Kidney(3.4)
  • Liver(3.3)
  • Intestine(3.2)
  • Blood(3)
  • Skin(3)
  • Muscle(2.7)
  • Heart(2.6)
  • Pancreas(2.5)
  • Lymph node(2.4)
  • Thyroid gland(2.3)
  • Spleen(2.3)
  • Bone marrow(2.3)
  • Stomach(2.2)
genes like me logo Genes that share expression patterns with PSMB1: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PSMB1 Gene

Orthologs for PSMB1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PSMB1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PSMB1 30 31
  • 99.59 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia PSMB1 31
  • 89 (a)
OneToOne
Cow
(Bos Taurus)
Mammalia PSMB1 30 31
  • 88.93 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia PSMB1 30 31
  • 88.52 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Psmb1 30
  • 85.57 (n)
Mouse
(Mus musculus)
Mammalia Psmb1 30 17 31
  • 85.29 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia PSMB1 31
  • 55 (a)
OneToOne
Chicken
(Gallus gallus)
Aves PSMB1 30 31
  • 79.01 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia PSMB1 31
  • 81 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia psmb1 30
  • 75.23 (n)
MGC75736 30
African clawed frog
(Xenopus laevis)
Amphibia psmb1-prov 30
Zebrafish
(Danio rerio)
Actinopterygii psmb1 30 31
  • 71.7 (n)
OneToOne
wufc51f06 30
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8243 30
Fruit Fly
(Drosophila melanogaster)
Insecta Pros26 30 31 32
  • 57.7 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP004991 30
  • 57.56 (n)
Worm
(Caenorhabditis elegans)
Secernentea pbs-6 30 31
  • 50.25 (n)
OneToOne
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_AGL324W 30
  • 54.98 (n)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PRE7 30 31 33
  • 54.46 (n)
OneToOne
K. Lactis Yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0E05633g 30
  • 54.07 (n)
Thale Cress
(Arabidopsis thaliana)
eudicotyledons PBF1 30
  • 54.09 (n)
Rice
(Oryza sativa)
Liliopsida Os09g0505600 30
  • 53.91 (n)
Fission Yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes pam1 30
  • 52.25 (n)
Bread mold
(Neurospora crassa)
Ascomycetes NCU09366 30
  • 52.01 (n)
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.4908 30
Species where no ortholog for PSMB1 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for PSMB1 Gene

ENSEMBL:
Gene Tree for PSMB1 (if available)
TreeFam:
Gene Tree for PSMB1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PSMB1: view image

Paralogs for PSMB1 Gene

Pseudogenes.org Pseudogenes for PSMB1 Gene

genes like me logo Genes that share paralogs with PSMB1: view

Variants for PSMB1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PSMB1 Gene