Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PPM1G Gene

Aliases for PPM1G Gene

  • Protein Phosphatase, Mg2+/Mn2+ Dependent 1G 2 3 5
  • Protein Phosphatase 1G (Formerly 2C), Magnesium-Dependent, Gamma Isoform 2 3
  • Protein Phosphatase Magnesium-Dependent 1 Gamma 3 4
  • Protein Phosphatase 2C Isoform Gamma 3 4
  • Protein Phosphatase 1C 3 4
  • EC 3.1.3.16 4 56
  • PP2C-Gamma 3 4
  • Protein Phosphatase 2, Catalytic Subunit, Gamma Isoform 3
  • Protein Phosphatase, Mg2+/Mn2+ Dependent, 1G 2
  • Protein Phosphatase 2C, Gamma Isoform 2
  • Protein Phosphatase 2C Gamma Isoform 3
  • Protein Phosphatase 1G 3
  • PP2C, Gamma 2
  • PP2CGAMMA 3
  • PPP2CG 3
  • PP2CG 3
  • PPM1C 4

External Ids for PPM1G Gene

Previous GeneCards Identifiers for PPM1G Gene

  • GC02M027525
  • GC02M027696
  • GC02M027561
  • GC02M027578
  • GC02M027516
  • GC02M027457
  • GC02M027604

Summaries for PPM1G Gene

Entrez Gene Summary for PPM1G Gene

  • The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. [provided by RefSeq, Apr 2010]

GeneCards Summary for PPM1G Gene

PPM1G (Protein Phosphatase, Mg2+/Mn2+ Dependent 1G) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Development Dopamine D2 receptor transactivation of EGFR. Gene Ontology (GO) annotations related to this gene include phosphoprotein phosphatase activity and protein serine/threonine phosphatase activity.

Gene Wiki entry for PPM1G Gene

Additional gene information for PPM1G Gene

No data available for CIViC summary , UniProtKB/Swiss-Prot , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PPM1G Gene

Genomics for PPM1G Gene

GeneHancer (GH) Regulatory Elements for PPM1G Gene

Promoters and enhancers for PPM1G Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH02I027407 Promoter/Enhancer 2.3 EPDnew FANTOM5 Ensembl ENCODE 550.8 +0.5 505 2.7 HDGF PKNOX1 FOXA2 SMAD1 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 PPM1G SNX17 SUPT7L ZNF512 GTF3C2 NRBP1 IFT172 TMEM214 CAD LOC105374363
GH02I026784 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 32.7 +623.6 623579 2.3 HDGF PKNOX1 CLOCK FOXA2 MLX ARNT ZFP64 ARID4B NEUROD1 SIN3A CENPA ASXL2 EIF2B4 NRBP1 GPN1 GTF3C2 PPM1G ATRAID CAD GTF3C2-AS1
GH02I027662 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 20.5 -254.0 -253959 2.4 CLOCK MLX ZFP64 FEZF1 DMAP1 IRF4 YY1 SLC30A9 ZNF213 E2F8 SUPT7L SLC4A1AP IFT172 GTF3C2 CAD ZNF512 GPN1 NRBP1 EIF2B4 SNX17
GH02I027069 Promoter/Enhancer 2.8 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 11.9 +333.2 333193 14.9 CLOCK MLX DMAP1 YBX1 IRF4 YY1 SLC30A9 E2F8 ZNF143 MCM3 EMILIN1 OST4 CAD GTF3C2 SNX17 NRBP1 LOC105374363 GPN1 KHK TMEM214
GH02I027626 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 11.8 -218.5 -218464 3.8 HDGF PKNOX1 SMAD1 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 YY1 GPN1 CCDC121 SNX17 CAD GTF3C2 GTF3C2-AS1 NRBP1 EIF2B4 ZNF513 PPM1G
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around PPM1G on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PPM1G gene promoter:

Genomic Locations for PPM1G Gene

Genomic Locations for PPM1G Gene
chr2:27,381,194-27,409,687
(GRCh38/hg38)
Size:
28,494 bases
Orientation:
Minus strand
chr2:27,604,061-27,632,554
(GRCh37/hg19)

Genomic View for PPM1G Gene

Genes around PPM1G on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PPM1G Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PPM1G Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PPM1G Gene

Proteins for PPM1G Gene

  • Protein details for PPM1G Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15355-PPM1G_HUMAN
    Recommended name:
    Protein phosphatase 1G
    Protein Accession:
    O15355

    Protein attributes for PPM1G Gene

    Size:
    546 amino acids
    Molecular mass:
    59272 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    • Interacts with NOL3; may dephosphorylate NOL3.

neXtProt entry for PPM1G Gene

Selected DME Specific Peptides for PPM1G Gene

O15355:
  • EDGYSSEEAENEEDEDDTEEAEEDD
  • ESGKRKLEE
  • DHKPEDEVE
  • EVALYCAK
  • DSEECSE
  • EEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDS
  • TGEAGPSCSSASDKLPRVAKSKFFEDSEDESDE
  • VYDGHGG
  • ANAGDSR
  • DAFLAIDAKLTTEEVIKELAQIAGRPTEDED
  • KVADEDDVDNEEAALLHEEATMTIEELLTRYGQNC
  • GTGCDNMT

Post-translational modifications for PPM1G Gene

  • Ubiquitination at Lys92, Lys209, Lys339, isoforms=358, isoforms=409, and Lys519

Other Protein References for PPM1G Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for PPM1G Gene

Gene Families for PPM1G Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for PPM1G Gene

Suggested Antigen Peptide Sequences for PPM1G Gene

Graphical View of Domain Structure for InterPro Entry

O15355

UniProtKB/Swiss-Prot:

PPM1G_HUMAN :
  • Belongs to the PP2C family.
Family:
  • Belongs to the PP2C family.
genes like me logo Genes that share domains with PPM1G: view

Function for PPM1G Gene

Molecular function for PPM1G Gene

UniProtKB/Swiss-Prot CatalyticActivity:
[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.

Enzyme Numbers (IUBMB) for PPM1G Gene

Phenotypes From GWAS Catalog for PPM1G Gene

Gene Ontology (GO) - Molecular Function for PPM1G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004721 phosphoprotein phosphatase activity IEA --
GO:0004722 protein serine/threonine phosphatase activity IDA 20801214
GO:0005515 protein binding IPI 17572683
GO:0016787 hydrolase activity IEA --
GO:0043169 cation binding IEA --
genes like me logo Genes that share ontologies with PPM1G: view
genes like me logo Genes that share phenotypes with PPM1G: view

Animal Models for PPM1G Gene

MGI Knock Outs for PPM1G:

Animal Model Products

CRISPR Products

miRNA for PPM1G Gene

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PPM1G Gene

Localization for PPM1G Gene

Subcellular locations from UniProtKB/Swiss-Prot for PPM1G Gene

Cytoplasm. Membrane; Lipid-anchor.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PPM1G gene
Compartment Confidence
nucleus 5
plasma membrane 1
cytoskeleton 1
mitochondrion 1
peroxisome 1
cytosol 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PPM1G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,TAS 9271424
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with PPM1G: view

Pathways & Interactions for PPM1G Gene

genes like me logo Genes that share pathways with PPM1G: view

Pathways by source for PPM1G Gene

1 BioSystems pathway for PPM1G Gene
1 R&D Systems pathway for PPM1G Gene
1 Qiagen pathway for PPM1G Gene

Gene Ontology (GO) - Biological Process for PPM1G Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006470 protein dephosphorylation TAS 9276438
GO:0007050 cell cycle arrest IEA --
GO:0035970 peptidyl-threonine dephosphorylation IDA 20801214
genes like me logo Genes that share ontologies with PPM1G: view

No data available for SIGNOR curated interactions for PPM1G Gene

Drugs & Compounds for PPM1G Gene

(5) Drugs for PPM1G Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Water Approved Pharma 0
calcium Approved Nutra 0
Magnesium Approved Nutra 0
Manganese Approved Nutra 37

(1) Additional Compounds for PPM1G Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Phosphate
  • NFB Orthophosphate
  • O-Phosphoric acid
  • Ortho-phosphate
  • Orthophosphate (PO43-)
  • Orthophosphate(3-)
14265-44-2
genes like me logo Genes that share compounds with PPM1G: view

Transcripts for PPM1G Gene

mRNA/cDNA for PPM1G Gene

Unigene Clusters for PPM1G Gene

Protein phosphatase, Mg2+/Mn2+ dependent, 1G:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for PPM1G Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10a · 10b
SP1:
SP2:
SP3:
SP4: -

Relevant External Links for PPM1G Gene

GeneLoc Exon Structure for
PPM1G
ECgene alternative splicing isoforms for
PPM1G

Expression for PPM1G Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PPM1G Gene

mRNA differential expression in normal tissues according to GTEx for PPM1G Gene

This gene is overexpressed in Testis (x4.9).

Protein differential expression in normal tissues from HIPED for PPM1G Gene

This gene is overexpressed in Bone marrow mesenchymal stem cell (14.6), Stomach (12.3), and Peripheral blood mononuclear cells (6.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PPM1G Gene



Protein tissue co-expression partners for PPM1G Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PPM1G Gene:

PPM1G

SOURCE GeneReport for Unigene cluster for PPM1G Gene:

Hs.643951

mRNA Expression by UniProt/SwissProt for PPM1G Gene:

O15355-PPM1G_HUMAN
Tissue specificity: Widely expressed. Most abundant in testis, skeletal muscle, and heart.

Evidence on tissue expression from TISSUES for PPM1G Gene

  • Skin(4.8)
  • Liver(4.7)
  • Nervous system(4.7)
  • Muscle(4.5)
  • Intestine(3.6)
  • Lung(3.6)
  • Kidney(3.3)
  • Eye(3.2)
  • Blood(2.2)
  • Adrenal gland(2.1)
  • Bone marrow(2.1)
  • Lymph node(2.1)
  • Pancreas(2.1)
genes like me logo Genes that share expression patterns with PPM1G: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for PPM1G Gene

Orthologs for PPM1G Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PPM1G Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PPM1G 33 34
  • 99.88 (n)
dog
(Canis familiaris)
Mammalia PPM1G 33 34
  • 94.61 (n)
cow
(Bos Taurus)
Mammalia PPM1G 33 34
  • 93.8 (n)
mouse
(Mus musculus)
Mammalia Ppm1g 33 16 34
  • 91.08 (n)
rat
(Rattus norvegicus)
Mammalia Ppm1g 33
  • 91.08 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PPM1G 34
  • 86 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia PPM1G 34
  • 82 (a)
OneToOne
chicken
(Gallus gallus)
Aves PPM1G 33 34
  • 76.55 (n)
lizard
(Anolis carolinensis)
Reptilia PPM1G 34
  • 60 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ppm1g 33
  • 72.86 (n)
Str.6654 33
African clawed frog
(Xenopus laevis)
Amphibia ppm1g-prov 33
zebrafish
(Danio rerio)
Actinopterygii ppm1g 33 34
  • 67.99 (n)
wufj67a11 33
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.3251 33
fruit fly
(Drosophila melanogaster)
Insecta CG10417 35 33 34
  • 58.43 (n)
worm
(Caenorhabditis elegans)
Secernentea T23F11.1 35
  • 47 (a)
F42G9.1 34
  • 40 (a)
OneToOne
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PTC4 34 36
  • 26 (a)
OneToMany
rice
(Oryza sativa)
Liliopsida Os09g0558000 33
  • 57.32 (n)
barley
(Hordeum vulgare)
Liliopsida Hv.8837 33
sea squirt
(Ciona savignyi)
Ascidiacea CSA.3875 34
  • 45 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.1963 33
Species where no ortholog for PPM1G was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PPM1G Gene

ENSEMBL:
Gene Tree for PPM1G (if available)
TreeFam:
Gene Tree for PPM1G (if available)

Paralogs for PPM1G Gene

No data available for Paralogs for PPM1G Gene

Variants for PPM1G Gene

Sequence variations from dbSNP and Humsavar for PPM1G Gene

SNP ID Clin Chr 02 pos Variation AA Info Type
rs886055910 uncertain-significance, Retinitis Pigmentosa, Dominant 27,380,729(-) CCCCC/CCCC/CCCCCC downstream_transcript_variant
rs929433743 uncertain-significance, Retinitis Pigmentosa, Dominant 27,380,739(-) C/G/T downstream_transcript_variant
rs1000086753 -- 27,398,868(-) G/T intron_variant
rs1000116319 -- 27,399,143(-) C/A intron_variant
rs1000279333 -- 27,386,128(-) C/T intron_variant

Structural Variations from Database of Genomic Variants (DGV) for PPM1G Gene

Variant ID Type Subtype PubMed ID
nsv961021 CNV duplication 23825009
nsv833614 CNV gain 17160897
nsv581244 CNV loss 21841781
esv3590136 CNV loss 21293372
esv3575209 CNV gain 25503493

Variation tolerance for PPM1G Gene

Residual Variation Intolerance Score: 31% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.59; 12.75% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PPM1G Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PPM1G

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PPM1G Gene

Disorders for PPM1G Gene

Additional Disease Information for PPM1G

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for PPM1G Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PPM1G Gene

Publications for PPM1G Gene

  1. PP2C gamma: a human protein phosphatase with a unique acidic domain. (PMID: 9276438) Travis SM … Welsh MJ (FEBS letters 1997) 2 3 4 58
  2. Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts. (PMID: 20468071) Dick DM … Bierut L (American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2010) 3 44 58
  3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
  4. Architecture of the human interactome defines protein communities and disease networks. (PMID: 28514442) Huttlin EL … Harper JW (Nature 2017) 3 58
  5. Systematic Analysis of Human Protein Phosphatase Interactions and Dynamics. (PMID: 28330616) Yadav L … Varjosalo M (Cell systems 2017) 3 58

Products for PPM1G Gene

Sources for PPM1G Gene

Content
Loading form....