This gene encodes a type II transmembrane protein that resides in the Golgi apparatus. It participates in O-mannosyl glycosylation and is specific for alpha linked terminal mannose. Mutations in this gene may be associated with muscle-eye-brain disease and several congenital muscular dystrophies. Alternatively spliced transcript variants that encode different protein isoforms h... See more...

Aliases for POMGNT1 Gene

Aliases for POMGNT1 Gene

  • Protein O-Linked Mannose N-Acetylglucosaminyltransferase 1 (Beta 1,2-) 2 3 5
  • UDP-GlcNAc:Alpha-D-Mannoside Beta-1,2-N-Acetylglucosaminyltransferase I.2 3 4
  • Protein O-Linked-Mannose Beta-1,2-N-Acetylglucosaminyltransferase 1 3 4
  • GnT I.2 3 4
  • MGAT1.2 3 4
  • Protein O-Linked Mannose Beta1,2-N-Acetylglucosaminyltransferase 2
  • Protein O-Mannose Beta-1,2-N-Acetylglucosaminyltransferase 2
  • Muscle-Eye-Brain Disease 2
  • EC 2.4.1.101 52
  • EC 2.4.1.- 4
  • EC 2.4.1 52
  • LGMDR15 3
  • GnT-I.2 3
  • POMGnT1 4
  • GNTI.2 3
  • LGMD2O 3
  • RP76 3
  • MEB 3

External Ids for POMGNT1 Gene

Previous HGNC Symbols for POMGNT1 Gene

  • MEB

Previous GeneCards Identifiers for POMGNT1 Gene

  • GC01M046367
  • GC01M046654
  • GC01M044769

Summaries for POMGNT1 Gene

Entrez Gene Summary for POMGNT1 Gene

  • This gene encodes a type II transmembrane protein that resides in the Golgi apparatus. It participates in O-mannosyl glycosylation and is specific for alpha linked terminal mannose. Mutations in this gene may be associated with muscle-eye-brain disease and several congenital muscular dystrophies. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Feb 2014]

GeneCards Summary for POMGNT1 Gene

POMGNT1 (Protein O-Linked Mannose N-Acetylglucosaminyltransferase 1 (Beta 1,2-)) is a Protein Coding gene. Diseases associated with POMGNT1 include Muscular Dystrophy-Dystroglycanopathy , Type C, 3 and Retinitis Pigmentosa 76. Among its related pathways are Metabolism of proteins and Mannose type O-glycan biosynthesis. Gene Ontology (GO) annotations related to this gene include acetylglucosaminyltransferase activity and beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT1.

UniProtKB/Swiss-Prot Summary for POMGNT1 Gene

  • Participates in O-mannosyl glycosylation by catalyzing the addition of N-acetylglucosamine to O-linked mannose on glycoproteins (PubMed:11709191, PubMed:27493216, PubMed:28512129). Catalyzes the synthesis of the GlcNAc(beta1-2)Man(alpha1-)O-Ser/Thr moiety on alpha-dystroglycan and other O-mannosylated proteins, providing the necessary basis for the addition of further carbohydrate moieties (PubMed:11709191, PubMed:27493216). Is specific for alpha linked terminal mannose and does not have MGAT3, MGAT4, MGAT5, MGAT7 or MGAT8 activity.

Gene Wiki entry for POMGNT1 Gene

Additional gene information for POMGNT1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for POMGNT1 Gene

Genomics for POMGNT1 Gene

GeneHancer (GH) Regulatory Elements for POMGNT1 Gene

Promoters and enhancers for POMGNT1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01J046196 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 511.9 +22.1 22059 2.8 HNRNPK CTCF POLR2G NCOR1 PHF8 ZFX POLR2A ZNF623 AFF1 ZBTB26 POMGNT1 LURAP1 P3R3URF PIK3R3 TSPAN1 RAD54L TOE1 MUTYH ZSWIM5 lnc-PIK3R3-4
GH01J046218 Enhancer 0.7 Ensembl ENCODE 500.7 +1.2 1249 1.5 ZSCAN5C REST ZNF585B ZBTB17 ZBTB48 TAF15 PRDM10 ZBTB6 POLR2A POMGNT1 LURAP1 P3R3URF PIK3R3 TSPAN1 ENSG00000226957 CCDC163 lnc-POMGNT1-2
GH01J046220 Enhancer 0.5 Ensembl 500.7 +0.0 4 0.2 RFX1 ZBTB48 EBF1 TAF15 ZNF770 BMI1 POMGNT1 piR-38723 lnc-POMGNT1-2 LURAP1
GH01J047024 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE CraniofacialAtlas 10.7 -803.7 -803696 1.6 ZSCAN5C ZNF10 ZIC2 ZBTB26 TRIM28 ATF2 ZNF341 ZNF148 OSR2 KLF9 CYP4X1 NSUN4 TEX38 LRRC41 LURAP1 POMGNT1 CYP4A22 CYP4Z1 piR-47211-015 piR-59769-010
GH01J045876 Enhancer 0.9 Ensembl 18.4 +344.1 344104 0.8 ZSCAN5C ZNF300 ZNF10 ZNF423 ZNF510 KLF7 ZNF662 ZEB1 ZNF148 OSR2 ZSWIM5 MUTYH LRRC41 NASP TOE1 MAST2 LURAP1 POMGNT1 IPP ENSG00000234329
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around POMGNT1 on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for POMGNT1

Top Transcription factor binding sites by QIAGEN in the POMGNT1 gene promoter:
  • Bach1
  • E2F
  • E2F-1
  • E2F-2
  • E2F-3a
  • E2F-5

Genomic Locations for POMGNT1 Gene

Genomic Locations for POMGNT1 Gene
chr1:46,188,681-46,220,305
(GRCh38/hg38)
Size:
31,625 bases
Orientation:
Minus strand
chr1:46,654,353-46,685,977
(GRCh37/hg19)
Size:
31,625 bases
Orientation:
Minus strand

Genomic View for POMGNT1 Gene

Genes around POMGNT1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
POMGNT1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for POMGNT1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for POMGNT1 Gene

Proteins for POMGNT1 Gene

  • Protein details for POMGNT1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8WZA1-PMGT1_HUMAN
    Recommended name:
    Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
    Protein Accession:
    Q8WZA1
    Secondary Accessions:
    • D3DQ16
    • Q5VST2
    • Q5VST3
    • Q9BV55
    • Q9H9L8
    • Q9NXF9
    • Q9NYF7

    Protein attributes for POMGNT1 Gene

    Size:
    660 amino acids
    Molecular mass:
    75252 Da
    Cofactor:
    Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    • Interacts with DAG1 (via O-linked mannose moiety) (PubMed:27493216). Interacts (via transmembrane domain) with FKTN; the interaction is direct and is required for normal location in Golgi membranes (PubMed:17034757).
    SequenceCaution:
    • Sequence=BAB14207.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for POMGNT1 Gene

    Alternative splice isoforms for POMGNT1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for POMGNT1 Gene

Selected DME Specific Peptides for POMGNT1 Gene

Q8WZA1:
  • PCEDSFLPDTEGHTYVAFIRME
  • IWDLDVRGNHRGLWRLFRKKNHFLVVGVPASPYS
  • GAVLFLL
  • HRLLSEAEVLDHSK
  • IKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVD
  • RSLLSAQG
  • ELEPKWP

Post-translational modifications for POMGNT1 Gene

  • Glycosylation at Thr524
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Abcam antibodies for POMGNT1

Domains & Families for POMGNT1 Gene

Gene Families for POMGNT1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Predicted membrane proteins

Protein Domains for POMGNT1 Gene

Suggested Antigen Peptide Sequences for POMGNT1 Gene

GenScript: Design optimal peptide antigens:
  • UDP-GlcNAc:alpha-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I.2 (PMGT1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q8WZA1

UniProtKB/Swiss-Prot:

PMGT1_HUMAN :
  • Amino acid residues between 299-311 are important for both protein expression and enzymatic activity. The minimal catalytic domain is located between positions 299-651. Single amino acid substitutions in the stem domain from MEB patients abolished the activity of the membrane-bound form but not the soluble form. This suggests that the stem domain of the soluble form is unnecessary for activity, but that some amino acids play a crucial role in the membrane-bound form.
  • Belongs to the glycosyltransferase 13 family.
Domain:
  • Amino acid residues between 299-311 are important for both protein expression and enzymatic activity. The minimal catalytic domain is located between positions 299-651. Single amino acid substitutions in the stem domain from MEB patients abolished the activity of the membrane-bound form but not the soluble form. This suggests that the stem domain of the soluble form is unnecessary for activity, but that some amino acids play a crucial role in the membrane-bound form.
  • The stem domain mediates specific interaction with beta-linked N-acetylglucosamine moieties of O-glycosylated proteins. It also interacts with its product, N-acetyl-beta-D-glucosaminyl-(1->2)-O-alpha-D-mannosylprotein.
Family:
  • Belongs to the glycosyltransferase 13 family.
genes like me logo Genes that share domains with POMGNT1: view

Function for POMGNT1 Gene

Molecular function for POMGNT1 Gene

UniProtKB/Swiss-Prot Function:
Participates in O-mannosyl glycosylation by catalyzing the addition of N-acetylglucosamine to O-linked mannose on glycoproteins (PubMed:11709191, PubMed:27493216, PubMed:28512129). Catalyzes the synthesis of the GlcNAc(beta1-2)Man(alpha1-)O-Ser/Thr moiety on alpha-dystroglycan and other O-mannosylated proteins, providing the necessary basis for the addition of further carbohydrate moieties (PubMed:11709191, PubMed:27493216). Is specific for alpha linked terminal mannose and does not have MGAT3, MGAT4, MGAT5, MGAT7 or MGAT8 activity.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=3-O-(alpha-D-mannosyl)-L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl)-L-threonyl-[protein] + H(+) + UDP; Xref=Rhea:RHEA:54128, Rhea:RHEA-COMP:13547, Rhea:RHEA-COMP:13802, ChEBI:CHEBI:15378, ChEBI:CHEBI:57705, ChEBI:CHEBI:58223, ChEBI:CHEBI:137323, ChEBI:CHEBI:138067; Evidence={ECO:0000269 PubMed:11709191, ECO:0000269 PubMed:11742540, ECO:0000269 PubMed:12788071, ECO:0000269 PubMed:26908613, ECO:0000269 PubMed:27391550, ECO:0000269 PubMed:27493216, ECO:0000269 PubMed:28512129};.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=1.85 mM for mannosylpeptide {ECO:0000269 PubMed:11709191, ECO:0000269 PubMed:11742540}; KM=0.73 mM for UDP-GlcNAc {ECO:0000269 PubMed:11709191, ECO:0000269 PubMed:11742540}; KM=30 mM for Man(alpha1-)O-benzyl {ECO:0000269 PubMed:11709191, ECO:0000269 PubMed:11742540}; KM=12 mM for CYA[Man(alpha1-)O-T]AV {ECO:0000269 PubMed:11709191, ECO:0000269 PubMed:11742540}; pH dependence: Optimum pH is 6.0. {ECO:0000269 PubMed:11709191, ECO:0000269 PubMed:11742540};

Enzyme Numbers (IUBMB) for POMGNT1 Gene

Phenotypes From GWAS Catalog for POMGNT1 Gene

Gene Ontology (GO) - Molecular Function for POMGNT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 17034757
GO:0008375 acetylglucosaminyltransferase activity IMP 26908613
GO:0016740 transferase activity IEA --
GO:0016757 transferase activity, transferring glycosyl groups IEA --
GO:0030145 manganese ion binding IDA 27493216
genes like me logo Genes that share ontologies with POMGNT1: view
genes like me logo Genes that share phenotypes with POMGNT1: view

Human Phenotype Ontology for POMGNT1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for POMGNT1 Gene

MGI Knock Outs for POMGNT1:

Animal Model Products

  • Taconic Biosciences Mouse Models for POMGNT1

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for POMGNT1

Clone Products

No data available for Transcription Factor Targets and HOMER Transcription for POMGNT1 Gene

Localization for POMGNT1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for POMGNT1 Gene

Golgi apparatus membrane; Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for POMGNT1 gene
Compartment Confidence
golgi apparatus 5
plasma membrane 4
extracellular 2
cytoskeleton 2
endoplasmic reticulum 2
mitochondrion 1
nucleus 1
cytosol 1
lysosome 1

Gene Ontology (GO) - Cellular Components for POMGNT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005794 Golgi apparatus IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA,IMP 27493216
GO:0030173 integral component of Golgi membrane IDA 17034757
genes like me logo Genes that share ontologies with POMGNT1: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for POMGNT1 Gene

Pathways & Interactions for POMGNT1 Gene

genes like me logo Genes that share pathways with POMGNT1: view

Pathways by source for POMGNT1 Gene

UniProtKB/Swiss-Prot Q8WZA1-PMGT1_HUMAN

  • Pathway: Protein modification; protein glycosylation.

SIGNOR curated interactions for POMGNT1 Gene

Is inactivated by:

Gene Ontology (GO) - Biological Process for POMGNT1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006486 protein glycosylation IEA --
GO:0006493 protein O-linked glycosylation TAS,IEA --
GO:0016266 O-glycan processing IDA,IBA 27493216
genes like me logo Genes that share ontologies with POMGNT1: view

Drugs & Compounds for POMGNT1 Gene

(4) Drugs for POMGNT1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Manganese Approved Nutra 51
N-Acetyl-D-glucosamine Approved, Investigational Nutra 0
Uridine 5'-diphosphate Experimental Pharma 0

(2) Additional Compounds for POMGNT1 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Uridine diphosphate-N-acetylglucosamine
  • (2R,3R,4R,5S,6R)-3-(acetylamino)-4,5-Dihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl [(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate (non-preferred name)
  • UDP-GlcNAc
  • UDP-N-Acetyl-D-glucosamine
  • UDP-N-Acetylglucosamine
  • URIDINE-diphosphATE-N-acetylglucosamine
528-04-1
genes like me logo Genes that share compounds with POMGNT1: view

Transcripts for POMGNT1 Gene

mRNA/cDNA for POMGNT1 Gene

4 REFSEQ mRNAs :
20 NCBI additional mRNA sequence :
10 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for POMGNT1

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for POMGNT1 Gene

ExUns: 1 ^ 2a · 2b · 2c · 2d · 2e ^ 3a · 3b ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12a · 12b ^ 13a · 13b ^ 14a · 14b ^ 15 ^ 16 ^
SP1: - - - - -
SP2: - -
SP3:
SP4:
SP5: - - - - - -
SP6:
SP7:
SP8:
SP9: - - -
SP10: -
SP11:
SP12:

ExUns: 17a · 17b ^ 18 ^ 19 ^ 20a · 20b ^ 21 ^ 22a · 22b ^ 23a · 23b · 23c ^ 24a · 24b · 24c
SP1: - -
SP2:
SP3:
SP4: - - -
SP5:
SP6: -
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

Relevant External Links for POMGNT1 Gene

GeneLoc Exon Structure for
POMGNT1

Expression for POMGNT1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for POMGNT1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for POMGNT1 Gene

This gene is overexpressed in Breast (30.5) and Serum (19.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for POMGNT1 Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for POMGNT1

SOURCE GeneReport for Unigene cluster for POMGNT1 Gene:

Hs.525134

mRNA Expression by UniProt/SwissProt for POMGNT1 Gene:

Q8WZA1-PMGT1_HUMAN
Tissue specificity: Constitutively expressed. An additional weaker band is also detected in spinal cord, lymph node, and trachea. Expressed especially in astrocytes. Also expressed in immature and mature neurons.

Evidence on tissue expression from TISSUES for POMGNT1 Gene

  • Nervous system(4.9)
  • Liver(4.2)
  • Muscle(2.9)

Phenotype-based relationships between genes and organs from Gene ORGANizer for POMGNT1 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • endocrine
  • integumentary
  • nervous
  • reproductive
  • respiratory
  • skeletal muscle
  • skeleton
  • urinary
Regions:
Head and neck:
  • brain
  • cerebellum
  • cerebrospinal fluid
  • cheek
  • chin
  • cranial nerve
  • ear
  • eye
  • face
  • forehead
  • head
  • inner ear
  • jaw
  • larynx
  • lip
  • mandible
  • maxilla
  • meninges
  • middle ear
  • mouth
  • neck
  • nose
  • outer ear
  • pituitary gland
  • skull
  • tongue
  • vocal cord
Thorax:
  • breast
  • chest wall
  • clavicle
  • heart
  • heart valve
  • lung
  • rib
  • rib cage
  • scapula
  • sternum
Abdomen:
  • intestine
  • kidney
  • large intestine
Pelvis:
  • anus
  • ovary
  • pelvis
  • penis
  • placenta
  • prostate
  • rectum
  • testicle
  • ureter
  • uterus
  • vagina
  • vulva
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • hair
  • peripheral nerve
  • peripheral nervous system
  • red blood cell
  • skin
  • spinal column
  • spinal cord
  • vertebrae
genes like me logo Genes that share expression patterns with POMGNT1: view

No data available for mRNA differential expression in normal tissues and Protein tissue co-expression partners for POMGNT1 Gene

Orthologs for POMGNT1 Gene

This gene was present in the common ancestor of animals.

Orthologs for POMGNT1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia POMGNT1 31
  • 100 (a)
OneToOne
dog
(Canis familiaris)
Mammalia POMGNT1 31 30
  • 93.84 (n)
OneToOne
cow
(Bos Taurus)
Mammalia POMGNT1 31 30
  • 93.64 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Pomgnt1 17 31 30
  • 92.37 (n)
rat
(Rattus norvegicus)
Mammalia Pomgnt1 30
  • 91.97 (n)
oppossum
(Monodelphis domestica)
Mammalia POMGNT1 31
  • 81 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia POMGNT1 31
  • 66 (a)
OneToOne
chicken
(Gallus gallus)
Aves POMGNT1 31 30
  • 77.83 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia POMGNT1 31
  • 80 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pomgnt1 30
  • 71.81 (n)
Str.11459 30
zebrafish
(Danio rerio)
Actinopterygii pomgnt1 31 30
  • 72.27 (n)
OneToOne
worm
(Caenorhabditis elegans)
Secernentea gly-12 31
  • 19 (a)
OneToOne
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 45 (a)
OneToOne
Species where no ortholog for POMGNT1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for POMGNT1 Gene

ENSEMBL:
Gene Tree for POMGNT1 (if available)
TreeFam:
Gene Tree for POMGNT1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for POMGNT1: view image

Paralogs for POMGNT1 Gene

Paralogs for POMGNT1 Gene

(1) SIMAP similar genes for POMGNT1 Gene using alignment to 3 proteins:

  • PMGT1_HUMAN
  • F5H827_HUMAN
  • Q5VST3_HUMAN
genes like me logo Genes that share paralogs with POMGNT1: view

Variants for POMGNT1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for POMGNT1 Gene

SNP ID Clinical significance and condition Chr 01 pos Variation AA Info Type
638451 Uncertain Significance: POMGNT1-Related Disorders 46,192,950(-) C/A MISSENSE_VARIANT
642652 Pathogenic: Congenital muscular dystrophy-dystroglycanopathy with mental retardation, type B3; Limb-girdle muscular dystrophy-dystroglycanopathy, type C3 46,197,811(-) CA/C FRAMESHIFT_VARIANT
642934 Likely Pathogenic: Congenital muscular dystrophy-dystroglycanopathy with mental retardation, type B3; Limb-girdle muscular dystrophy-dystroglycanopathy, type C3 46,194,843(-) C/A SPLICE_DONOR_VARIANT
643942 Uncertain Significance: Congenital muscular dystrophy-dystroglycanopathy with mental retardation, type B3; Limb-girdle muscular dystrophy-dystroglycanopathy, type C3 46,189,477(-) C/T MISSENSE_VARIANT,INTRON_VARIANT
644042 Uncertain Significance: Congenital muscular dystrophy-dystroglycanopathy with mental retardation, type B3; Limb-girdle muscular dystrophy-dystroglycanopathy, type C3 46,192,913(-) C/G MISSENSE_VARIANT

Additional dbSNP identifiers (rs#s) for POMGNT1 Gene

Structural Variations from Database of Genomic Variants (DGV) for POMGNT1 Gene

Variant ID Type Subtype PubMed ID
esv1137837 CNV insertion 17803354
esv2761743 CNV gain 21179565
esv3306122 CNV mobile element insertion 20981092
esv3326121 CNV insertion 20981092
nsv470711 CNV gain 18288195
nsv527878 CNV gain 19592680
nsv822520 CNV loss 20364138

Variation tolerance for POMGNT1 Gene

Residual Variation Intolerance Score: 22.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.67; 45.96% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for POMGNT1 Gene

Human Gene Mutation Database (HGMD)
POMGNT1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
POMGNT1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for POMGNT1 Gene

Disorders for POMGNT1 Gene

MalaCards: The human disease database

(55) MalaCards diseases for POMGNT1 Gene - From: UniProtKB/Swiss-Prot, OMIM, ClinVar, GTR, Orphanet, DISEASES, Novoseek, and GeneCards

UniProtKB/Swiss-Prot

PMGT1_HUMAN
  • Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A3 (MDDGA3) [MIM:253280]: An autosomal recessive disorder characterized by congenital muscular dystrophy, ocular abnormalities, cobblestone lissencephaly, and cerebellar and pontine hypoplasia. Patients present severe congenital myopia, congenital glaucoma, pallor of the optic disks, retinal hypoplasia, mental retardation, hydrocephalus, abnormal electroencephalograms, generalized muscle weakness and myoclonic jerks. Included diseases are the more severe Walker-Warburg syndrome and the slightly less severe muscle-eye-brain disease. {ECO:0000269 PubMed:11709191, ECO:0000269 PubMed:12588800, ECO:0000269 PubMed:12788071, ECO:0000269 PubMed:15207699, ECO:0000269 PubMed:15236414, ECO:0000269 PubMed:15466003, ECO:0000269 PubMed:17030669, ECO:0000269 PubMed:19067344}. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Muscular dystrophy-dystroglycanopathy congenital with mental retardation B3 (MDDGB3) [MIM:613151]: An autosomal recessive disorder characterized by congenital muscular dystrophy associated with mental retardation and mild structural brain abnormalities. Clinical features include mental retardation, white matter changes, cerebellar cysts, pontine hypoplasia, myopia, optic atrophy, decreased alpha-dystroglycan on muscle biopsy and increased serum creatine kinase. {ECO:0000269 PubMed:17030669, ECO:0000269 PubMed:19067344, ECO:0000269 PubMed:19299310}. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Muscular dystrophy-dystroglycanopathy limb-girdle C3 (MDDGC3) [MIM:613157]: A rare form of limb-girdle muscular dystrophy with normal cognition. Muscle biopsy shows dystrophic changes with variable staining for glycosylated alpha-dystroglycan. {ECO:0000269 PubMed:18195152}. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Retinitis pigmentosa 76 (RP76) [MIM:617123]: A form of retinitis pigmentosa, a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP76 inheritance is autosomal recessive. {ECO:0000269 PubMed:26908613, ECO:0000269 PubMed:27391550}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Additional Disease Information for POMGNT1

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with POMGNT1: view

No data available for Genatlas for POMGNT1 Gene

Publications for POMGNT1 Gene

  1. Congenital muscular dystrophies with defective glycosylation of dystroglycan: a population study. (PMID: 19299310) Mercuri E … Bertini E (Neurology 2009) 3 4 23 41 54
  2. Loss-of-function of an N-acetylglucosaminyltransferase, POMGnT1, in muscle-eye-brain disease. (PMID: 12788071) Manya H … Endo T (Biochemical and biophysical research communications 2003) 2 3 4 23 54
  3. Cloning and expression of a novel UDP-GlcNAc:alpha-D-mannoside beta1,2-N-acetylglucosaminyltransferase homologous to UDP-GlcNAc:alpha-3-D-mannoside beta1,2-N-acetylglucosaminyltransferase I. (PMID: 11742540) Zhang W … Schachter H (The Biochemical journal 2002) 2 3 4 23 54
  4. Refining genotype phenotype correlations in muscular dystrophies with defective glycosylation of dystroglycan. (PMID: 17878207) Godfrey C … Muntoni F (Brain : a journal of neurology 2007) 3 23 41 54
  5. POMGnT1 gene alterations in a family with neurological abnormalities. (PMID: 15236414) Vervoort VS … Srivastava AK (Annals of neurology 2004) 3 4 23 54

Products for POMGNT1 Gene

Sources for POMGNT1 Gene