Free for academic non-profit institutions. Other users need a Commercial license

PLD2 Gene(Protein Coding)

Phospholipase D2

GCID:
GC17P004808
GIFtS:
57
Genes Participants
UDN Logo

Aliases for PLD2 Gene

Aliases for PLD2 Gene

  • Phospholipase D2 2 3 5
  • Choline Phosphatase 2 2 3 4
  • Phosphatidylcholine-Hydrolyzing Phospholipase D2 3 4
  • EC 3.1.4.4 4 56
  • PLD1C 3 4
  • PLD 2 4
  • HPLD2 4

External Ids for PLD2 Gene

Previous GeneCards Identifiers for PLD2 Gene

  • GC17P005137
  • GC17P004661
  • GC17P004917
  • GC17P004657
  • GC17P004710
  • GC17P004598

Summaries for PLD2 Gene

Entrez Gene Summary for PLD2 Gene

  • The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localizes to the peripheral membrane and may be involved in cytoskeletal organization, cell cycle control, transcriptional regulation, and/or regulated secretion. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]

GeneCards Summary for PLD2 Gene

PLD2 (Phospholipase D2) is a Protein Coding gene. Diseases associated with PLD2 include Tooth Agenesis. Among its related pathways are Translation Translation regulation by Alpha-1 adrenergic receptors and Circadian entrainment. Gene Ontology (GO) annotations related to this gene include phosphatidylinositol binding and N-acylphosphatidylethanolamine-specific phospholipase D activity. An important paralog of this gene is PLD1.

UniProtKB/Swiss-Prot for PLD2 Gene

  • May have a role in signal-induced cytoskeletal regulation and/or endocytosis.

Tocris Summary for PLD2 Gene

  • Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.

Gene Wiki entry for PLD2 Gene

Additional gene information for PLD2 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLD2 Gene

Genomics for PLD2 Gene

Products:

  1. Regulatory Element

GeneHancer (GH) Regulatory Elements for PLD2 Gene

Promoters and enhancers for PLD2 Gene
GeneHancer (GH) Identifier GH Type GH
Score		 GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites		 Gene Targets
GH17I004806 Promoter/Enhancer 1.8 EPDnew Ensembl ENCODE 565.3 +0.1 98 1.6 RB1 SIN3A ZNF48 ZNF335 GLIS2 ZNF213 ZNF366 ZSCAN5C REST ELF1 PLD2 ENSG00000262165 GC17M004737
GH17I004808 Enhancer 0.6 ENCODE 550.8 +1.2 1165 0.2 RXRA MAX REST RAD21 NR2F2 GABPA GLIS2 ZBTB20 PLD2 ENSG00000262165 GC17M004737
GH17I004795 Promoter/Enhancer 2 EPDnew Ensembl ENCODE 16.8 -10.9 -10854 1.7 HDGF FOXA2 PKNOX1 MLX ARNT ARID4B SIN3A DMAP1 YY1 POLR2B PSMB6 ZNF594 PLD2 LOC100130950 ENSG00000262165 LOC101927979 ZZEF1 PELP1 C17orf107 GC17M004737
GH17I004852 Enhancer 1.3 FANTOM5 Ensembl ENCODE dbSUPER 12.9 +46.5 46539 3.3 NFIA NFIB CBFB ZIC2 ZFHX2 NFIC POLR2A KLF16 ZNF547 PRDM10 CHRNE MINK1 PLD2 ZMYND15 CXCL16 SLC25A11 RNF167 SPAG7 ENO3 PFN1
GH17I004847 Enhancer 1.3 FANTOM5 Ensembl ENCODE dbSUPER 12.8 +42.5 42536 4.4 PKNOX1 ZBTB6 MAX ZBTB40 RFX5 SMC3 RCOR1 FOS SMARCE1 STAT1 CHRNE ENO3 PFN1 ZMYND15 ARRB2 C17orf107 PLD2 CXCL16 LOC101559451 PELP1
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around PLD2 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PLD2 gene promoter:

Genomic Locations for PLD2 Gene

Genomic Locations for PLD2 Gene
chr17:4,807,096-4,823,434
(GRCh38/hg38)
Size:
16,339 bases
Orientation:
Plus strand
chr17:4,710,391-4,726,729
(GRCh37/hg19)

Genomic View for PLD2 Gene

Genes around PLD2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLD2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLD2 Gene
GeneLoc Logo Genomic Neighborhood • Exon Structure • Gene Density

RefSeq DNA sequence for PLD2 Gene

Proteins for PLD2 Gene

Products:

  1. Antibody
  2. Protein
  3. Assay

  • Protein details for PLD2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O14939-PLD2_HUMAN
    Recommended name:
    Phospholipase D2
    Protein Accession:
    O14939
    Secondary Accessions:
    • I3L2C9
    • O43540
    • O43579
    • O43580
    • Q6PGR0
    • Q96BY3

    Protein attributes for PLD2 Gene

    Size:
    933 amino acids
    Molecular mass:
    105987 Da
    Quaternary structure:
    • Interacts with EGFR (By similarity). Interacts with PIP5K1B.

    Alternative splice isoforms for PLD2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PLD2 Gene

Protein Expression for PLD2 Gene

See protein expression from ProteomicsDB, MOPED, PaxDb, and MaxQB

Selected DME Specific Peptides for PLD2 Gene

O14939:
  • IGSANIN
  • EYQAGRFA
  • INSGYSK
  • KEVELAL
  • YIENQFF
  • ARHFIQRWNFTK
  • LGKRDSE
  • EEIFITDWWLSPE
  • DFIDRET
  • KDWVQLD
  • LPGFEGDISTGGGN
  • DLAYGRWDD
  • VKDSFLLYM
  • LHPNIKVMRHPD
  • ASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPD
  • EGEDPADRMHP
  • AQVVGTERYTSGSKVGTCTLYSVRLTHGDF
  • LWAHHEKL
  • HPLVFAPGVPV
  • CYRWSKRWL

Post-translational modifications for PLD2 Gene

Other Protein References for PLD2 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for PLD2 Gene

Gene Families for PLD2 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for PLD2 Gene

InterPro:
Blocks:
ProtoNet:

Suggested Antigen Peptide Sequences for PLD2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O14939

UniProtKB/Swiss-Prot:

PLD2_HUMAN :
  • Belongs to the phospholipase D family.
Family:
  • Belongs to the phospholipase D family.
genes like me logo Genes that share domains with PLD2: view

Function for PLD2 Gene

Products:

  1. Animal Model
  2. CRISPR
  3. miRNA
  4. Inhibitory RNA
  5. Clone
  6. Cell Line

Molecular function for PLD2 Gene

GENATLAS Biochemistry:
phospholipase D2,106kDa,phosphatidylcholine specific,widely expressed,involved in metabolic regulation,cardiac and brain function,senescence regulated secretion,mitogenesis and cytoskeletal changes
UniProtKB/Swiss-Prot CatalyticActivity:
A phosphatidylcholine + H(2)O = choline + a phosphatidate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Stimulated by phosphatidylinositol 4,5-bisphosphate and activated by the ADP-ribosylation factor-1 (ARF-1).
UniProtKB/Swiss-Prot Function:
May have a role in signal-induced cytoskeletal regulation and/or endocytosis.

Enzyme Numbers (IUBMB) for PLD2 Gene

Phenotypes From GWAS Catalog for PLD2 Gene

Gene Ontology (GO) - Molecular Function for PLD2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004630 phospholipase D activity TAS --
GO:0005515 protein binding IPI 16407827
GO:0016787 hydrolase activity IEA --
GO:0035091 phosphatidylinositol binding IEA --
GO:0070290 N-acylphosphatidylethanolamine-specific phospholipase D activity IEA --
genes like me logo Genes that share ontologies with PLD2: view
genes like me logo Genes that share phenotypes with PLD2: view

Animal Models for PLD2 Gene

MGI Knock Outs for PLD2:

Animal Model Products

miRNA for PLD2 Gene

miRTarBase miRNAs that target PLD2

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLD2 Gene

Localization for PLD2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLD2 Gene

Membrane; Peripheral membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLD2 gene
Compartment Confidence
plasma membrane 5
nucleus 4
endoplasmic reticulum 4
cytosol 4
golgi apparatus 4
endosome 2
extracellular 1
cytoskeleton 1
mitochondrion 1
lysosome 1

Gene Ontology (GO) - Cellular Components for PLD2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005789 endoplasmic reticulum membrane TAS --
GO:0005794 Golgi apparatus IBA --
GO:0005886 plasma membrane TAS --
GO:0016020 membrane IEA --
GO:0098793 presynapse IEA --
genes like me logo Genes that share ontologies with PLD2: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for PLD2 Gene

Pathways & Interactions for PLD2 Gene

genes like me logo Genes that share pathways with PLD2: view

SIGNOR curated interactions for PLD2 Gene

Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for PLD2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006654 phosphatidic acid biosynthetic process IEA,TAS --
GO:0007010 cytoskeleton organization TAS 9395408
GO:0007264 small GTPase mediated signal transduction TAS 9582313
GO:0016042 lipid catabolic process IEA --
genes like me logo Genes that share ontologies with PLD2: view

Drugs & Compounds for PLD2 Gene

Products:

  1. Drug

(24) Drugs for PLD2 Gene - From: DrugBank, DGIdb, IUPHAR, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
oleic acid Approved, Investigational, Vet_approved Pharma Full agonist, Agonist 0
Choline Approved Nutra Target, product of 176
Water Approved Pharma 0
Zinc Approved, Investigational Pharma 2430
Ethanolamine Experimental Pharma 0

(45) Additional Compounds for PLD2 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
PA(16:0/16:0)
  • 1,2-Di-O-palmitoyl-3-sn-glyceryl-O-phosphorate
  • 1,2-Di-O-palmitoyl-3-sn-glyceryl-O-phosphoric acid
  • 1,2-Dihexadecanoyl-rac-phosphatidic acid
  • 1,2-Dipalmitoyl-3-sn-phosphatidate
  • 1,2-Dipalmitoyl-3-sn-phosphatidic acid
 7091-44-3
PA(16:0/18:1(11Z))
  • 1-Hexadecanoyl-2-(11Z-octadecenoyl)-sn-phosphatidic acid
  • 1-Palmitoyl-2-vaccenoyl-sn-glycero-3-phosphate
  • PA(16:0/18:1)
  • PA(16:0/18:1n7)
  • PA(16:0/18:1w7)
PA(16:0/18:1(9Z))
  • 1-Hexadecanoyl-2-(9Z-octadecenoyl)-sn-phosphatidic acid
  • 1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphate
  • PA(16:0/18:1)
  • PA(16:0/18:1n9)
  • PA(16:0/18:1w9)
PA(16:0/18:2(9Z,12Z))
  • 1-Hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-phosphatidic acid
  • 1-Palmitoyl-2-linoleoyl-sn-glycero-3-phosphate
  • PA(16:0/18:2)
  • PA(16:0/18:2n6)
  • PA(16:0/18:2w6)
PA(18:0/18:2(9Z,12Z))
  • 1-Octadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-phosphatidic acid
  • 1-Stearoyl-2-linoleoyl-sn-glycero-3-phosphate
  • PA(18:0/18:2)
  • PA(18:0/18:2n6)
  • PA(18:0/18:2w6)

(5) Tocris Compounds for PLD2 Gene

Compound Action Cas Number
AACOCF3 Phospholipase A2 inhibitor 149301-79-1
Edelfosine Selective PI-PLC inhibitor, also PAF receptor agonist 77286-66-9
m-3M3FBS Phospholipase C activator 200933-14-8
o-3M3FBS Inactive analog of m-3M3FBS (Cat. No. 1941) 313981-55-4
U 73122 Phospholipase C inhibitor 112648-68-7
genes like me logo Genes that share compounds with PLD2: view

Transcripts for PLD2 Gene

Products:

  1. CRISPR
  2. miRNA
  3. Inhibitory RNA
  4. Clone

mRNA/cDNA for PLD2 Gene

(4) REFSEQ mRNAs :
(9) Additional mRNA sequences :
(155) Selected AceView cDNA sequences:
(15) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for PLD2 Gene

Phospholipase D2:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PLD2 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14a · 14b ^ 15a · 15b · 15c ^ 16 ^ 17a · 17b ^ 18 ^ 19a ·
SP1: - - - -
SP2: - - - -
SP3:
SP4:
SP5:
SP6:
SP7:

ExUns: 19b ^ 20 ^ 21 ^ 22 ^ 23a · 23b · 23c ^ 24 ^ 25a · 25b
SP1:
SP2: -
SP3:
SP4:
SP5:
SP6:
SP7:

Relevant External Links for PLD2 Gene

GeneLoc Exon Structure for
PLD2
ECgene alternative splicing isoforms for
PLD2

Expression for PLD2 Gene

Products:

  1. Primer
  2. Gene Expression Assay

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PLD2 Gene

mRNA expression in normal human tissues for PLD2 Gene
mRNA expression by BioGPS for PLD2 GenemRNA expression by GTEx for PLD2 Gene

mRNA differential expression in normal tissues according to GTEx for PLD2 Gene

This gene is overexpressed in Esophagus - Mucosa (x4.3).

Protein differential expression in normal tissues from HIPED for PLD2 Gene

This gene is overexpressed in Platelet (25.7), Cervix (19.1), and Liver, secretome (8.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PLD2 Gene



NURSA nuclear receptor signaling pathways regulating expression of PLD2 Gene:

PLD2

SOURCE GeneReport for Unigene cluster for PLD2 Gene:

Hs.104519

mRNA Expression by UniProt/SwissProt for PLD2 Gene:

O14939-PLD2_HUMAN
Tissue specificity: Ubiquitous.

Evidence on tissue expression from TISSUES for PLD2 Gene

  • Nervous system(4.7)
  • Skin(4.4)
  • Adrenal gland(2)
  • Kidney(2)
genes like me logo Genes that share expression patterns with PLD2: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PLD2 Gene

Orthologs for PLD2 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PLD2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
 Mammalia PLD2 34 33
  • 98.71 (n)
 OneToOne
cow
(Bos Taurus)
 Mammalia PLD2 34 33
  • 90.35 (n)
 OneToOne
rat
(Rattus norvegicus)
 Mammalia Pld2 33
  • 87.5 (n)
mouse
(Mus musculus)
 Mammalia Pld2 33 16 34
  • 87.17 (n)
dog
(Canis familiaris)
 Mammalia PLD2 33 34
  • 84.82 (n)
oppossum
(Monodelphis domestica)
 Mammalia PLD2 34
  • 76 (a)
 OneToOne
platypus
(Ornithorhynchus anatinus)
 Mammalia PLD2 34
  • 71 (a)
 OneToOne
lizard
(Anolis carolinensis)
 Reptilia -- 34
  • 49 (a)
 ManyToMany
tropical clawed frog
(Silurana tropicalis)
 Amphibia pld2 33
  • 64 (n)
zebrafish
(Danio rerio)
 Actinopterygii pld2 33 34
  • 61.35 (n)
fruit fly
(Drosophila melanogaster)
 Insecta Pld 35 34
  • 47 (a)
worm
(Caenorhabditis elegans)
 Secernentea pld-1 35 34
  • 47 (a)
baker's yeast
(Saccharomyces cerevisiae)
 Saccharomycetes SPO14 34 36
  • 18 (a)
 OneToMany
barley
(Hordeum vulgare)
 Liliopsida Hv.2078 33
corn
(Zea mays)
 Liliopsida Zm.50 33
sea squirt
(Ciona savignyi)
 Ascidiacea -- 34
  • 34 (a)
 OneToMany
Species where no ortholog for PLD2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PLD2 Gene

ENSEMBL:
Gene Tree for PLD2 (if available)
TreeFam:
Gene Tree for PLD2 (if available)

Paralogs for PLD2 Gene

Paralogs for PLD2 Gene

(1) SIMAP similar genes for PLD2 Gene using alignment to 8 proteins:

genes like me logo Genes that share paralogs with PLD2: view

Variants for PLD2 Gene

Products:

  1. SNP Genotyping and Copy Number Assay

Sequence variations from dbSNP and Humsavar for PLD2 Gene

SNP ID Clin Chr 17 pos Variation AA Info Type
VAR_036503 A breast cancer sample p.Gln807Glu
rs386352350 uncertain-significance, not provided 4,817,011(+) C/T coding_sequence_variant, intron_variant, missense_variant, non_coding_transcript_variant
rs1000158222 -- 4,811,763(+) G/A intron_variant
rs1000190931 -- 4,821,123(+) C/A/T intron_variant
rs1000257454 -- 4,818,935(+) G/A intron_variant

Structural Variations from Database of Genomic Variants (DGV) for PLD2 Gene

Variant ID Type Subtype PubMed ID
esv3639795 CNV loss 21293372
nsv574273 CNV gain 21841781
nsv820043 CNV loss 19587683
nsv833346 CNV loss 17160897
nsv833347 CNV loss 17160897

Variation tolerance for PLD2 Gene

Residual Variation Intolerance Score: 81.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 13.96; 95.99% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PLD2 Gene

Human Gene Mutation Database (HGMD)
PLD2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PLD2

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PLD2 Gene

Disorders for PLD2 Gene

MalaCards: The human disease database

(1) MalaCards diseases for PLD2 Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
tooth agenesis
  • familial tooth agenesis
- elite association - COSMIC cancer census association via MalaCards
Search PLD2 in MalaCards View complete list of genes associated with diseases

Additional Disease Information for PLD2

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
genes like me logo Genes that share disorders with PLD2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PLD2 Gene

Publications for PLD2 Gene

  1. Cloning and initial characterization of a human phospholipase D2 (hPLD2). ADP-ribosylation factor regulates hPLD2. (PMID: 9582313) Lopez I … Lambeth JD (The Journal of biological chemistry 1998) 2 3 4 22 58
  2. Interaction of the type Ialpha PIPkinase with phospholipase D: a role for the local generation of phosphatidylinositol 4, 5-bisphosphate in the regulation of PLD2 activity. (PMID: 11032811) Divecha N … D'Santos C (The EMBO journal 2000) 3 4 22 58
  3. Characterization of human PLD2 and the analysis of PLD isoform splice variants. (PMID: 9761774) Steed PM … Lasala DJ (FASEB journal : official publication of the Federation of American Societies for Experimental Biology 1998) 3 4 22 58
  4. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 44 58
  5. Epidermal growth factor increases lysophosphatidic acid production in human ovarian cancer cells: roles for phospholipase D2 and receptor transactivation. (PMID: 19864325) Snider AJ … Meier KE (American journal of physiology. Cell physiology 2010) 3 22 58

Products for PLD2 Gene

Sources for PLD2 Gene

Content
Loading form....