The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guani... See more...

Aliases for PLCG1 Gene

Aliases for PLCG1 Gene

  • Phospholipase C Gamma 1 2 3 5
  • 1-Phosphatidylinositol 4,5-Bisphosphate Phosphodiesterase Gamma-1 3 4
  • Phospholipase C, Gamma 1 (Formerly Subtype 148) 2 3
  • Phosphoinositide Phospholipase C-Gamma-1 3 4
  • Phospholipase C-II 3 4
  • PLC-Gamma-1 3 4
  • EC 3.1.4.11 4 54
  • PLC-148 3 4
  • PLC-II 3 4
  • PLC1 3 4
  • 1-Phosphatidyl-D-Myo-Inositol-4,5-Bisphosphate 3
  • Monophosphatidylinositol Phosphodiesterase 3
  • Triphosphoinositide Phosphodiesterase 3
  • Phosphatidylinositol Phospholipase C 3
  • Phosphoinositide Phospholipase C 3
  • Inositoltrisphosphohydrolase 3
  • Phospholipase C, Gamma 1 2
  • Phospholipase C-Gamma-1 4
  • Phosphoinositidase C 3
  • Phospholipase C-148 3
  • PLCgamma1 3
  • NCKAP3 3
  • PLC148 3

External Ids for PLCG1 Gene

Previous HGNC Symbols for PLCG1 Gene

  • PLC1

Previous GeneCards Identifiers for PLCG1 Gene

  • GC20P039494
  • GC20P040404
  • GC20P040451
  • GC20P039199
  • GC20P039765
  • GC20P036506

Summaries for PLCG1 Gene

Entrez Gene Summary for PLCG1 Gene

  • The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for PLCG1 Gene

PLCG1 (Phospholipase C Gamma 1) is a Protein Coding gene. Diseases associated with PLCG1 include Spleen Angiosarcoma and Mycobacterium Kansasii. Among its related pathways are TCR signaling (REACTOME) and Development FGFR signaling pathway. Gene Ontology (GO) annotations related to this gene include calcium ion binding and obsolete signal transducer activity. An important paralog of this gene is PLCG2.

UniProtKB/Swiss-Prot Summary for PLCG1 Gene

  • Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.

Tocris Summary for PLCG1 Gene

  • Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.

Gene Wiki entry for PLCG1 Gene

Additional gene information for PLCG1 Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PLCG1 Gene

Genomics for PLCG1 Gene

GeneHancer (GH) Regulatory Elements for PLCG1 Gene

Promoters and enhancers for PLCG1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH20J041136 Promoter/Enhancer 2.4 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 777.2 +3.0 2966 7.5 SP1 SREBF1 ZBTB6 MLX RBPJ POLR2A USF2 NR2F1 NR2F6 MYC PLCG1 PLCG1-AS1 CHD6 TOP1 LPIN3 MIR6871
GH20J041135 Enhancer 1.1 ENCODE dbSUPER 750.6 -1.4 -1408 0.5 CTCF RBPJ MIXL1 CC2D1A RBM39 RAD21 MNT ELF3 TFE3 SP5 PLCG1 TOP1 PLCG1-AS1 lnc-PLCG1-2
GH20J041137 Enhancer 0.4 CraniofacialAtlas dbSUPER 750.6 -0.9 -899 0.2 ZBTB33 PLCG1 PLCG1-AS1 lnc-PLCG1-2
GH20J041313 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 38.9 +179.9 179944 5.9 ZNF785 SIN3A ZBTB40 ZBTB6 MLX RBPJ POLR2A NR2F1 NR2F6 MIXL1 ZHX3 lnc-ZHX3-4 PLCG1 TOP1 CHD6 PLCG1-AS1 LPIN3 L13714-289
GH20J041339 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas 20.4 +204.6 204607 4.3 ZNF24 CTCF MLX RBPJ POLR2A NR2F1 NR2F6 MIXL1 RUNX1 CC2D1A LPIN3 CHD6 TOP1 PLCG1 PLCG1-AS1 MAFB NONHSAG031795.2
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PLCG1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PLCG1 gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • CREB
  • deltaCREB

Genomic Locations for PLCG1 Gene

Genomic Locations for PLCG1 Gene
chr20:41,136,960-41,196,801
(GRCh38/hg38)
Size:
59,842 bases
Orientation:
Plus strand
chr20:39,765,600-39,811,629
(GRCh37/hg19)
Size:
46,030 bases
Orientation:
Plus strand

Genomic View for PLCG1 Gene

Genes around PLCG1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLCG1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLCG1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLCG1 Gene

Proteins for PLCG1 Gene

  • Protein details for PLCG1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P19174-PLCG1_HUMAN
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
    Protein Accession:
    P19174
    Secondary Accessions:
    • B7ZLY7
    • B9EGH4
    • E1P5W4
    • Q2V575

    Protein attributes for PLCG1 Gene

    Size:
    1290 amino acids
    Molecular mass:
    148532 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Quaternary structure:
    • Interacts with AGAP2 via its SH3 domain. Interacts (via SH2 domain) with RET. Interacts with FLT1 (tyrosine-phosphorylated) (By similarity). Interacts (via SH2 domain) with FGFR1, FGFR2, FGFR3 and FGFR4 (phosphorylated). Interacts with LAT (phosphorylated) upon TCR activation. Interacts (via SH3 domain) with the Pro-rich domain of TNK1. Associates with BLNK, VAV1, GRB2 and NCK1 in a B-cell antigen receptor-dependent fashion. Interacts with CBLB in activated T-cells; which inhibits phosphorylation. Interacts with SHB. Interacts (via SH3 domain) with the Arg/Gly-rich-flanked Pro-rich domains of KHDRBS1/SAM68. This interaction is selectively regulated by arginine methylation of KHDRBS1/SAM68. Interacts with INPP5D/SHIP1, THEMIS and CLNK (By similarity). Interacts with AXL, FLT4 and KIT. Interacts with RALGPS1. Interacts (via the SH2 domains) with VIL1 (phosphorylated at C-terminus tyrosine phosphorylation sites). Interacts (via SH2 domain) with PDGFRA and PDGFRB (tyrosine phosphorylated). Interacts with PIP5K1C (By similarity). Interacts with NTRK1 and NTRK2 (phosphorylated upon ligand-binding). Interacts with SYK; activates PLCG1. Interacts with GRB2, LAT and THEMIS upon TCR activation in thymocytes (By similarity). Interacts with TESPA1; the association is increased with prolonged stimulation of the TCR and may facilitate the assembly of the LAT signalosome.
    • (Microbial infection) Interacts (via SH3 domain) with HEV ORF3 protein.

    Three dimensional structures from OCA and Proteopedia for PLCG1 Gene

    Alternative splice isoforms for PLCG1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PLCG1 Gene

Selected DME Specific Peptides for PLCG1 Gene

P19174:
  • MYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYY
  • SEYPVILS
  • VYEEDMFSD
  • GCRCIELDCWDGPDG
  • KQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEE
  • QLSRIYP
  • VLGARHLPK
  • DYTLSFWR
  • SSHNTYL
  • VALNFQT
  • ENGDLSPF
  • YHGHTLT
  • EIKEIRPGK

Post-translational modifications for PLCG1 Gene

  • Tyrosine phosphorylated in response to signaling via activated FLT3, KIT and PDGFRA (By similarity). Tyrosine phosphorylated by activated FGFR1, FGFR2, FGFR3 and FGFR4. Tyrosine phosphorylated by activated FLT1 and KDR. Tyrosine phosphorylated by activated PDGFRB. The receptor-mediated activation of PLCG1 involves its phosphorylation by tyrosine kinases, in response to ligation of a variety of growth factor receptors and immune system receptors. For instance, SYK phosphorylates and activates PLCG1 in response to ligation of the B-cell receptor. May be dephosphorylated by PTPRJ. Phosphorylated by ITK and TXK on Tyr-783 upon TCR activation in T-cells.
  • Ubiquitinated by CBLB in activated T-cells.
  • Ubiquitination at Lys178, Lys226, Lys431, Lys440, and Lys941
  • Modification sites at PhosphoSitePlus

Antibody Products

Domains & Families for PLCG1 Gene

Suggested Antigen Peptide Sequences for PLCG1 Gene

GenScript: Design optimal peptide antigens:
  • Phospholipase C, gamma 1, isoform CRA_b (A2A284_HUMAN)
  • Phospholipase C-gamma-1 (PLCG1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P19174

UniProtKB/Swiss-Prot:

PLCG1_HUMAN :
  • The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
Domain:
  • The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
genes like me logo Genes that share domains with PLCG1: view

Function for PLCG1 Gene

Molecular function for PLCG1 Gene

UniProtKB/Swiss-Prot Function:
Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+); Xref=Rhea:RHEA:33179, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17815, ChEBI:CHEBI:58456, ChEBI:CHEBI:203600; EC=3.1.4.11;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by phosphorylation on tyrosine residues.
GENATLAS Biochemistry:
phospholipase C,gamma 1 (subtype 148),phosphatidylinositol specific,involved in signal transduction,directly interacting with phosphorylated PTK2 to promote adhesion-dependent association of the two molecules and increase inositol-phosphate production (mouse fibroblasts)

Enzyme Numbers (IUBMB) for PLCG1 Gene

Phenotypes From GWAS Catalog for PLCG1 Gene

Gene Ontology (GO) - Molecular Function for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004435 phosphatidylinositol phospholipase C activity IEA,TAS --
GO:0004629 phospholipase C activity TAS --
GO:0005168 neurotrophin TRKA receptor binding IPI 15488758
GO:0005509 calcium ion binding IEA --
GO:0005515 protein binding IEA,IPI 1396585
genes like me logo Genes that share ontologies with PLCG1: view
genes like me logo Genes that share phenotypes with PLCG1: view

Animal Models for PLCG1 Gene

MGI Knock Outs for PLCG1:

Animal Model Products

CRISPR Products

miRNA for PLCG1 Gene

miRTarBase miRNAs that target PLCG1

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLCG1 Gene

Localization for PLCG1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLCG1 Gene

Cell projection, lamellipodium. Cell projection, ruffle. Note=Rapidly redistributed to ruffles and lamellipodia structures in response to epidermal growth factor (EGF) treatment.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLCG1 gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 5
cytoskeleton 2
extracellular 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001726 ruffle IEA,IDA 17229814
GO:0005737 cytoplasm IDA 15702972
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane IBA,TAS --
GO:0005911 cell-cell junction IEA --
genes like me logo Genes that share ontologies with PLCG1: view

Pathways & Interactions for PLCG1 Gene

PathCards logo

SuperPathways for PLCG1 Gene

SuperPathway Contained pathways
1 RET signaling
2 Downstream signaling of activated FGFR2
3 IL-2 Pathway
.59
.54
.51
.49
.49
.48
.47
.43
.37
.35
4 Immune response Fc epsilon RI pathway
5 superpathway of inositol phosphate compounds
genes like me logo Genes that share pathways with PLCG1: view

Pathways by source for PLCG1 Gene

86 Qiagen pathways for PLCG1 Gene
  • 14-3-3 Induced Intracellular Signaling
  • Activation of cAMP-Dependent PKA
  • Activation of PKA through GPCR
  • Activation of PKC through GPCR
  • Aldosterone Signaling in Epithelial Cells
1 Cell Signaling Technology pathway for PLCG1 Gene
1 GeneTex pathway for PLCG1 Gene

SIGNOR curated interactions for PLCG1 Gene

Gene Ontology (GO) - Biological Process for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001701 in utero embryonic development IEA --
GO:0006629 lipid metabolic process IEA --
GO:0007165 signal transduction IEA,TAS --
GO:0007173 epidermal growth factor receptor signaling pathway IMP 22454520
GO:0007202 activation of phospholipase C activity TAS --
genes like me logo Genes that share ontologies with PLCG1: view

Drugs & Compounds for PLCG1 Gene

(47) Drugs for PLCG1 Gene - From: PharmGKB, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Calcium Approved Nutra 7773
Acetaminophen Approved Pharma 1258
Aspirin Approved, Vet_approved Pharma Channel blocker 1403
Diclofenac Approved, Vet_approved Pharma Channel blocker, Antagonist, Inhibition, Inhibitor 391
Water Approved Pharma 0

(428) Additional Compounds for PLCG1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
edelfosine
77286-66-9
Phosphatidylinositol-3,4,5-trisphosphate
  • 1,2-Diacyl-sn-glycero-3-phospho-(1'-myo-inositol-3',4',5'-bisphosphate)
  • 1-Phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate
U 73122
112648-68-7
Diglycerides Group A
  • 1-arachidonyl-3-behenoyl-sn-glycerol
  • DAG(42:0)
  • Diacylglycerol(20:0/0:0/22:0)
  • DG(42:0)
  • Diglyceride
Diglycerides Group B
  • 1-Myristoyl-2-eicosadienoyl-sn-glycerol
  • DAG(14:0/20:2)
  • DAG(14:0/20:2N6)
  • DAG(14:0/20:2W6)
  • DAG(34:2)

(5) Tocris Compounds for PLCG1 Gene

Compound Action Cas Number
AACOCF3 Phospholipase A2 inhibitor 149301-79-1
Edelfosine Selective PI-PLC inhibitor, also PAF receptor agonist 77286-66-9
m-3M3FBS Phospholipase C activator 200933-14-8
o-3M3FBS Inactive analog of m-3M3FBS (Cat. No. 1941) 313981-55-4
U 73122 Phospholipase C inhibitor 112648-68-7
genes like me logo Genes that share compounds with PLCG1: view

Transcripts for PLCG1 Gene

mRNA/cDNA for PLCG1 Gene

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PLCG1 Gene

ExUns: 1 ^ 2a · 2b · 2c · 2d ^ 3a · 3b ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18a ·
SP1: - - -
SP2:
SP3:
SP4: - -
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

ExUns: 18b ^ 19 ^ 20 ^ 21a · 21b ^ 22a · 22b ^ 23 ^ 24 ^ 25a · 25b ^ 26a · 26b ^ 27 ^ 28a · 28b · 28c ^ 29 ^ 30 ^ 31 ^ 32 ^ 33a · 33b ^ 34a · 34b
SP1: - - - -
SP2: - -
SP3:
SP4:
SP5:
SP6: -<