Aliases for PJA2 Gene

Aliases for PJA2 Gene

  • Praja Ring Finger Ubiquitin Ligase 2 2 3 5
  • Praja Ring Finger 2, E3 Ubiquitin Protein Ligase 2 3
  • RING-Type E3 Ubiquitin Transferase Praja-2 3 4
  • E3 Ubiquitin-Protein Ligase Praja-2 3 4
  • Ring Finger Protein 131 2 3
  • Neurodap1 2 3
  • KIAA0438 2 4
  • RNF131 3 4
  • Praja2 3 4
  • Praja 2, RING-H2 Motif Containing 3
  • RING Finger Protein 131 4
  • Praja Ring Finger 2 2
  • EC 2.3.2.27 4
  • EC 6.3.2 51
  • PJA2 5

External Ids for PJA2 Gene

Previous HGNC Symbols for PJA2 Gene

  • RNF131

Previous GeneCards Identifiers for PJA2 Gene

  • GC05M108701
  • GC05M108746
  • GC05M108733
  • GC05M108698
  • GC05M103843
  • GC05M108670

Summaries for PJA2 Gene

GeneCards Summary for PJA2 Gene

PJA2 (Praja Ring Finger Ubiquitin Ligase 2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include ligase activity and protein kinase A catalytic subunit binding. An important paralog of this gene is PJA1.

UniProtKB/Swiss-Prot Summary for PJA2 Gene

  • Has E2-dependent E3 ubiquitin-protein ligase activity. Responsible for ubiquitination of cAMP-dependent protein kinase type I and type II-alpha/beta regulatory subunits and for targeting them for proteasomal degradation. Essential for PKA-mediated long-term memory processes. Through the ubiquitination of MFHAS1, positively regulates the TLR2 signaling pathway that leads to the activation of the downstream p38 and JNK MAP kinases and promotes the polarization of macrophages toward the pro-inflammatory M1 phenotype (PubMed:28471450).

Gene Wiki entry for PJA2 Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PJA2 Gene

Genomics for PJA2 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PJA2 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH05J109406 Promoter/Enhancer 2.7 EPDnew FANTOM5 Ensembl ENCODE CraniofacialAtlas dbSUPER 263.2 +0.3 335 5.7 CHD2 TBP ZBTB10 BCL11A SP1 MXD4 FEZF1 CEBPA NR2C1 MNT PJA2 lnc-FER-17 lnc-TMEM232-7 LOC285638 LINC01023 MAN2A1 FER
GH05J109412 Enhancer 1.2 FANTOM5 ENCODE CraniofacialAtlas dbSUPER 7.8 -3.5 -3486 1.5 BCL11A MYNN TBP JUND HNF4A TAF1 BMI1 NR2F1 RFX1 SP7 LOC285638 PJA2 lnc-FER-17 HSALNG0044064 MAN2A1
GH05J109468 Enhancer 1.2 Ensembl ENCODE 8.3 -58.8 -58844 0.8 MXD4 FEZF1 MNT CTCF ZEB1 ZIC2 HOMEZ ZNF610 THAP11 ZNF513 ENSG00000251367 FER LINC01023 PJA2 HSALNG0044069 ENSG00000248876 lnc-MAN2A1-11 LOC105379117 MAN2A1
GH05J109454 Enhancer 1.1 FANTOM5 ENCODE 8.5 -45.6 -45600 2.6 SP1 BCL11A FEZF1 ZEB1 REST IRF4 EP300 EBF1 ZNF843 SP2 HSALNG0044066 lnc-MAN2A1-11 LOC285638 PJA2 LOC105379117 MAN2A1
GH05J109328 Enhancer 0.6 Ensembl ENCODE 12.8 +80.2 80177 2.4 MAFK JUND CEBPB POLR2A FOS CEBPG PJA2 LOC285638 piR-42806-012 FER
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PJA2 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PJA2

Top Transcription factor binding sites by QIAGEN in the PJA2 gene promoter:
  • AP-1
  • c-Fos
  • c-Jun
  • C/EBPbeta
  • FosB
  • Fra-1
  • JunB
  • JunD
  • Sp1
  • YY1

Genomic Locations for PJA2 Gene

Latest Assembly
chr5:109,334,709-109,409,978
(GRCh38/hg38)
Size:
75,270 bases
Orientation:
Minus strand

Previous Assembly
chr5:108,670,423-108,745,675
(GRCh37/hg19 by Entrez Gene)
Size:
75,253 bases
Orientation:
Minus strand

chr5:108,670,410-108,745,695
(GRCh37/hg19 by Ensembl)
Size:
75,286 bases
Orientation:
Minus strand

Genomic View for PJA2 Gene

Genes around PJA2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PJA2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PJA2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PJA2 Gene

Proteins for PJA2 Gene

  • Protein details for PJA2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O43164-PJA2_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase Praja-2
    Protein Accession:
    O43164
    Secondary Accessions:
    • A8K6U4
    • D3DSZ5
    • Q68D49
    • Q8N1G5

    Protein attributes for PJA2 Gene

    Size:
    708 amino acids
    Molecular mass:
    78214 Da
    Quaternary structure:
    • Binds ubiquitin-conjugating enzymes (E2s). In vitro, interacts with the ubiquitin-conjugating enzyme, UBE2D2. The phosphorylated form interacts with PRKAR1A, PRKAR2A and PRKAR2B. Binds the catalytic subunits of cAMP-dependent protein kinase. Interacts with MFHAS1 (PubMed:28471450).
    SequenceCaution:
    • Sequence=BAA23710.2; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};

    Alternative splice isoforms for PJA2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PJA2 Gene

Selected DME Specific Peptides for PJA2 Gene

O43164:
  • TGRRYGRRHAYVSF
  • ATELPCHH
  • FMLDGNNNLEDDSSVSEDL
  • VDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQA
  • FHKPCVSIWLQKSGTCPVCR

Post-translational modifications for PJA2 Gene

  • Ubiquitination at Lys268, Lys320, and Lys339
  • Modification sites at PhosphoSitePlus

Other Protein References for PJA2 Gene

Domains & Families for PJA2 Gene

Gene Families for PJA2 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for PJA2 Gene

InterPro:
Blocks:
  • Zn-finger, RING
  • N-6 Adenine-specific DNA methylase
ProtoNet:

Suggested Antigen Peptide Sequences for PJA2 Gene

GenScript: Design optimal peptide antigens:
  • RING finger protein 131 (PJA2_HUMAN)
genes like me logo Genes that share domains with PJA2: view

No data available for Graphical View of Domain Structure and UniProtKB/Swiss-Prot for PJA2 Gene

Function for PJA2 Gene

Molecular function for PJA2 Gene

UniProtKB/Swiss-Prot Function:
Has E2-dependent E3 ubiquitin-protein ligase activity. Responsible for ubiquitination of cAMP-dependent protein kinase type I and type II-alpha/beta regulatory subunits and for targeting them for proteasomal degradation. Essential for PKA-mediated long-term memory processes. Through the ubiquitination of MFHAS1, positively regulates the TLR2 signaling pathway that leads to the activation of the downstream p38 and JNK MAP kinases and promotes the polarization of macrophages toward the pro-inflammatory M1 phenotype (PubMed:28471450).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27;.

Enzyme Numbers (IUBMB) for PJA2 Gene

Phenotypes From GWAS Catalog for PJA2 Gene

Gene Ontology (GO) - Molecular Function for PJA2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity IDA 21423175
GO:0005515 protein binding IPI 28471450
GO:0016740 transferase activity IEA --
GO:0034236 protein kinase A catalytic subunit binding IMP 21423175
GO:0034237 protein kinase A regulatory subunit binding IMP 21423175
genes like me logo Genes that share ontologies with PJA2: view
genes like me logo Genes that share phenotypes with PJA2: view

Animal Models for PJA2 Gene

MGI Knock Outs for PJA2:
  • Pja2 Pja2<tm1b(EUCOMM)Wtsi>

miRNA for PJA2 Gene

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PJA2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PJA2 Gene

Localization for PJA2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PJA2 Gene

Cytoplasm. Cell membrane. Endoplasmic reticulum membrane. Peripheral membrane protein. Golgi apparatus membrane. Peripheral membrane protein. Cell junction, synapse. Cell junction, synapse, postsynaptic density. Note=Localizes at the cytoplasmic side of endoplasmic reticulum and Golgi apparatus. Expressed in the postsynaptic density region of synapses (By similarity). Colocalizes with PRKAR2A and PRKAR2B in the cytoplasm and the cell membrane. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PJA2 gene
Compartment Confidence
plasma membrane 5
cytoskeleton 4
nucleus 3
golgi apparatus 3
cytosol 2
extracellular 1
mitochondrion 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Intermediate filaments (4)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PJA2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane IEA --
GO:0005737 cytoplasm IEA,IDA 21423175
GO:0005783 endoplasmic reticulum IEA --
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0005794 Golgi apparatus IEA --
genes like me logo Genes that share ontologies with PJA2: view

Pathways & Interactions for PJA2 Gene

genes like me logo Genes that share pathways with PJA2: view

Pathways by source for PJA2 Gene

UniProtKB/Swiss-Prot O43164-PJA2_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for PJA2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006954 inflammatory response IMP 28471450
GO:0007616 long-term memory ISS --
GO:0010738 regulation of protein kinase A signaling IBA,IMP 21423175
GO:0016567 protein ubiquitination IMP 28471450
GO:0034137 positive regulation of toll-like receptor 2 signaling pathway IMP 28471450
genes like me logo Genes that share ontologies with PJA2: view

No data available for SIGNOR curated interactions for PJA2 Gene

Drugs & Compounds for PJA2 Gene

No Compound Related Data Available

Transcripts for PJA2 Gene

mRNA/cDNA for PJA2 Gene

1 REFSEQ mRNAs :
8 NCBI additional mRNA sequence :
4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PJA2

Alternative Splicing Database (ASD) splice patterns (SP) for PJA2 Gene

ExUns: 1 ^ 2a · 2b · 2c ^ 3 ^ 4 ^ 5a · 5b · 5c ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11
SP1:
SP2: - - -
SP3: -
SP4:

Relevant External Links for PJA2 Gene

GeneLoc Exon Structure for
PJA2

Expression for PJA2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PJA2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PJA2 Gene

This gene is overexpressed in Bone (19.0), Frontal cortex (10.2), Fetal Brain (9.1), Testis (8.5), and Blymphocyte (7.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PJA2 Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PJA2

SOURCE GeneReport for Unigene cluster for PJA2 Gene:

Hs.483036

Evidence on tissue expression from TISSUES for PJA2 Gene

  • Nervous system(4.9)
  • Liver(4.5)
  • Kidney(2.3)
  • Spleen(2)
genes like me logo Genes that share expression patterns with PJA2: view

Primer products for research

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PJA2 Gene

Orthologs for PJA2 Gene

This gene was present in the common ancestor of chordates.

Orthologs for PJA2 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PJA2 30 31
  • 99.39 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia PJA2 30 31
  • 89.2 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia PJA2 30 31
  • 87.65 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Pja2 30 17 31
  • 85.27 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pja2 30
  • 84.33 (n)
Oppossum
(Monodelphis domestica)
Mammalia -- 31
  • 56 (a)
OneToMany
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 31
  • 34 (a)
OneToMany
Chicken
(Gallus gallus)
Aves PJA2 30
  • 63.51 (n)
-- 31
  • 48 (a)
OneToMany
Lizard
(Anolis carolinensis)
Reptilia -- 31
  • 49 (a)
OneToMany
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia pja2 30
  • 57.54 (n)
Str.4831 30
African clawed frog
(Xenopus laevis)
Amphibia Xl.13459 30
Zebrafish
(Danio rerio)
Actinopterygii LOC101882388 30
  • 58.89 (n)
pja2 31
  • 38 (a)
OneToMany
Dr.6114 30
Species where no ortholog for PJA2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Fruit Fly (Drosophila melanogaster)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)
  • Worm (Caenorhabditis elegans)

Evolution for PJA2 Gene

ENSEMBL:
Gene Tree for PJA2 (if available)
TreeFam:
Gene Tree for PJA2 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PJA2: view image

Paralogs for PJA2 Gene

Paralogs for PJA2 Gene

(2) SIMAP similar genes for PJA2 Gene using alignment to 1 proteins:

  • PJA2_HUMAN
genes like me logo Genes that share paralogs with PJA2: view

Variants for PJA2 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PJA2 Gene

SNP ID Clinical significance and condition Chr 05 pos Variation AA Info Type
rs1045706 - p.Gln297Arg
rs246105 - p.Ala705Thr
rs35224970 - p.Glu176Gly

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for PJA2 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for PJA2 Gene

Variant ID Type Subtype PubMed ID
esv1180527 CNV insertion 17803354
esv1229231 CNV deletion 17803354
esv23192 CNV gain 19812545
esv2730587 CNV deletion 23290073
esv2763481 CNV gain 21179565
esv3303267 CNV mobile element insertion 20981092
esv3378334 CNV insertion 20981092
esv3421599 CNV insertion 20981092
nsv1073479 CNV deletion 25765185
nsv1077993 CNV duplication 25765185
nsv1114715 CNV deletion 24896259
nsv1141499 CNV duplication 24896259
nsv1142001 OTHER inversion 24896259
nsv327359 CNV deletion 16902084
nsv472753 CNV novel sequence insertion 20440878
nsv477073 CNV novel sequence insertion 20440878
nsv599338 CNV gain 21841781
nsv950112 CNV duplication 24416366

Variation tolerance for PJA2 Gene

Residual Variation Intolerance Score: 34.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 10.39; 90.86% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PJA2 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PJA2

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PJA2 Gene

Disorders for PJA2 Gene

Additional Disease Information for PJA2

No disorders were found for PJA2 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PJA2 Gene

Publications for PJA2 Gene

  1. Ubiquitylation of MFHAS1 by the ubiquitin ligase praja2 promotes M1 macrophage polarization by activating JNK and p38 pathways. (PMID: 28471450) Zhong J … Miao C (Cell death & disease 2017) 3 4
  2. Control of PKA stability and signalling by the RING ligase praja2. (PMID: 21423175) Lignitto L … Feliciello A (Nature cell biology 2011) 3 4
  3. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PMID: 17081983) Olsen JV … Mann M (Cell 2006) 3 4
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
  5. PJA1, encoding a RING-H2 finger ubiquitin ligase, is a novel human X chromosome gene abundantly expressed in brain. (PMID: 12036302) Yu P … Cai T (Genomics 2002) 3 4

Products for PJA2 Gene

Sources for PJA2 Gene