Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PISD Gene

Aliases for PISD Gene

  • Phosphatidylserine Decarboxylase 2 3 5
  • Phosphatidylserine Decarboxylase Proenzyme, Mitochondrial 3 4
  • EC 4.1.1.65 4 56
  • DJ858B16.2 3
  • DJ858B16 3
  • PSDC 3
  • PSSC 3
  • PSD 3

External Ids for PISD Gene

Previous GeneCards Identifiers for PISD Gene

  • GC22M028710
  • GC22M030339
  • GC22M032014
  • GC22M014973

Summaries for PISD Gene

Entrez Gene Summary for PISD Gene

  • The protein encoded by this gene catalyzes the conversion of phosphatidylserine to phosphatidylethanolamine in the inner mitochondrial membrane. The encoded protein is active in phospholipid metabolism and interorganelle trafficking of phosphatidylserine. [provided by RefSeq, May 2016]

GeneCards Summary for PISD Gene

PISD (Phosphatidylserine Decarboxylase) is a Protein Coding gene. Among its related pathways are Glycerophospholipid biosynthesis and FOXA1 transcription factor network. Gene Ontology (GO) annotations related to this gene include phosphatidylserine decarboxylase activity.

UniProtKB/Swiss-Prot for PISD Gene

  • Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer). Plays a central role in phospholipid metabolism and in the interorganelle trafficking of phosphatidylserine.

Gene Wiki entry for PISD Gene

Additional gene information for PISD Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PISD Gene

Genomics for PISD Gene

GeneHancer (GH) Regulatory Elements for PISD Gene

Promoters and enhancers for PISD Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH22J031621 Promoter/Enhancer 2.8 VISTA EPDnew Ensembl ENCODE dbSUPER 608.5 +35.5 35470 9.8 HDGF CC2D1A ZKSCAN8 MNT CBFA2T2 NKRF POLR2A MLLT1 ZNF121 ZSCAN21 PISD TUG1 PRR14L DEPDC5 SLC5A4 ENSG00000232218 MORC2 SFI1 DUSP18 RTCB
GH22J031658 Promoter/Enhancer 2.5 EPDnew Ensembl ENCODE dbSUPER 608 +1.5 1517 5.2 HDGF SP1 MNT NKRF POLR2A ZNF121 GTF2F1 ZSCAN21 NFRKB BACH1 PISD TUG1 RTCB MORC2 PRR14L DEPDC5 RNF185 EIF4ENIF1 ENSG00000240591 PIK3IP1
GH22J031637 Promoter/Enhancer 1.4 Ensembl ENCODE dbSUPER 7.9 +23.8 23832 3.5 ZNF687 MLLT1 IKZF1 POLR2A BACH1 IKZF2 SMAD5 TRIM22 PKNOX1 SCRT2 PISD PIK3IP1 SFI1 RNF185 MIR7109
GH22J031645 Enhancer 1.4 FANTOM5 ENCODE dbSUPER 7.6 +15.3 15313 4.1 SP1 ZNF687 ZSCAN21 RELA SP7 CREM PRDM1 FOSL2 IKZF1 CREB1 SFI1 EIF4ENIF1 ENSG00000240591 DRG1 PISD RNF185 PIK3IP1 LIMK2 MIR7109
GH22J031493 Promoter/Enhancer 2 EPDnew Ensembl ENCODE 4.7 +166.9 166865 4.6 ZFX MNT NKRF ZNF384 TFE3 SP7 ELF1 POLR2A KLF14 CREM SFI1 EIF4ENIF1 PIK3IP1 PISD DRG1
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PISD on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PISD gene promoter:
  • AML1a
  • AREB6
  • C/EBPbeta
  • E47
  • Hand1
  • Lmo2
  • Olf-1
  • p53
  • PPAR-gamma1
  • PPAR-gamma2

Genomic Locations for PISD Gene

Genomic Locations for PISD Gene
chr22:31,618,491-31,662,564
(GRCh38/hg38)
Size:
44,074 bases
Orientation:
Minus strand
chr22:32,014,477-32,058,418
(GRCh37/hg19)
Size:
43,942 bases
Orientation:
Minus strand

Genomic View for PISD Gene

Genes around PISD on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PISD Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PISD Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PISD Gene

Proteins for PISD Gene

  • Protein details for PISD Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UG56-PISD_HUMAN
    Recommended name:
    Phosphatidylserine decarboxylase proenzyme, mitochondrial
    Protein Accession:
    Q9UG56
    Secondary Accessions:
    • B1AKM7
    • O43207
    • O95535
    • Q6IC28
    • Q96GQ2
    • Q9UGA9

    Protein attributes for PISD Gene

    Size:
    409 amino acids
    Molecular mass:
    46672 Da
    Cofactor:
    Name=pyruvate; Xref=ChEBI:CHEBI:15361;
    Quaternary structure:
    • Heterodimer of a large membrane-associated beta subunit and a small pyruvoyl-containing alpha subunit.
    SequenceCaution:
    • Sequence=CAB43678.2; Type=Erroneous translation; Evidence={ECO:0000305};

    Alternative splice isoforms for PISD Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PISD Gene

Selected DME Specific Peptides for PISD Gene

Q9UG56:
  • VIYLAPGDYH
  • EAAVEDLHHYRNLSEFFRRKLKPQARPVCGLH
  • LYKSVPTRLLSRA
  • EVEQVKGVTYSLESFLGPR
  • GRLNQVELP
  • DLHTNSPR
  • FHSPTDW
  • WLRRPVYSLYIWTFGVNM

Post-translational modifications for PISD Gene

  • Is synthesized initially as an inactive proenzyme. Formation of the active enzyme involves a self-maturation process in which the active site pyruvoyl group is generated from an internal serine residue via an autocatalytic post-translational modification. Two non-identical subunits are generated from the proenzyme in this reaction, and the pyruvate is formed at the N-terminus of the alpha chain, which is derived from the carboxyl end of the proenzyme. The autoendoproteolytic cleavage occurs by a canonical serine protease mechanism, in which the side chain hydroxyl group of the serine supplies its oxygen atom to form the C-terminus of the beta chain, while the remainder of the serine residue undergoes an oxidative deamination to produce ammonia and the pyruvoyl prosthetic group on the alpha chain. During this reaction, the Ser that is part of the protease active site of the proenzyme becomes the pyruvoyl prosthetic group, which constitutes an essential element of the active site of the mature decarboxylase.
  • Ubiquitination at posLast=262262 and isoforms=3312
  • Modification sites at PhosphoSitePlus

Domains & Families for PISD Gene

Gene Families for PISD Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for PISD Gene

Suggested Antigen Peptide Sequences for PISD Gene

GenScript: Design optimal peptide antigens:
  • Phosphatidylserine decarboxylase (B1AJZ0_HUMAN)
  • Phosphatidylserine decarboxylase proenzyme (PISD_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9UG56

UniProtKB/Swiss-Prot:

PISD_HUMAN :
  • Belongs to the phosphatidylserine decarboxylase family. PSD-B subfamily. Eukaryotic type I sub-subfamily.
Family:
  • Belongs to the phosphatidylserine decarboxylase family. PSD-B subfamily. Eukaryotic type I sub-subfamily.
genes like me logo Genes that share domains with PISD: view

Function for PISD Gene

Molecular function for PISD Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer). Plays a central role in phospholipid metabolism and in the interorganelle trafficking of phosphatidylserine.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2-diacyl-sn-glycero-3-phospho-L-serine + H(+) = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CO2; Xref=Rhea:RHEA:20828, ChEBI:CHEBI:15378, ChEBI:CHEBI:16526, ChEBI:CHEBI:57262, ChEBI:CHEBI:64612; EC=4.1.1.65; Evidence=. ;.
GENATLAS Biochemistry:
phosphatidylserine decarboxylase

Enzyme Numbers (IUBMB) for PISD Gene

Phenotypes From GWAS Catalog for PISD Gene

Gene Ontology (GO) - Molecular Function for PISD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004609 phosphatidylserine decarboxylase activity IBA 21873635
GO:0016829 lyase activity IEA --
GO:0016831 carboxy-lyase activity IEA --
genes like me logo Genes that share ontologies with PISD: view
genes like me logo Genes that share phenotypes with PISD: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PISD

CRISPR Products

miRNA for PISD Gene

miRTarBase miRNAs that target PISD

Clone Products

  • Applied Biological Materials (abm): Clones for PISD - Now 50% OFF >
  • * PISD as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
  • * PISD tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PISD Gene

Localization for PISD Gene

Subcellular locations from UniProtKB/Swiss-Prot for PISD Gene

Phosphatidylserine decarboxylase beta chain: Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side.
Phosphatidylserine decarboxylase alpha chain: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side. Note=Anchored to the mitochondrial inner membrane through its interaction with the integral membrane beta chain. {ECO:0000255 HAMAP-Rule:MF_03208}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PISD gene
Compartment Confidence
mitochondrion 4
nucleus 4
cytosol 3
golgi apparatus 2
peroxisome 1
endoplasmic reticulum 1
endosome 1
extracellular 0

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Golgi apparatus (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PISD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA --
GO:0005739 mitochondrion IBA 21873635
GO:0005743 mitochondrial inner membrane IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with PISD: view

Pathways & Interactions for PISD Gene

genes like me logo Genes that share pathways with PISD: view

Pathways by source for PISD Gene

Gene Ontology (GO) - Biological Process for PISD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006646 phosphatidylethanolamine biosynthetic process IBA 21873635
GO:0008654 phospholipid biosynthetic process IEA --
GO:0016540 protein autoprocessing IEA --
genes like me logo Genes that share ontologies with PISD: view

No data available for SIGNOR curated interactions for PISD Gene

Drugs & Compounds for PISD Gene

(8) Drugs for PISD Gene - From: DrugBank, DGIdb, IUPHAR, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphatidyl serine Approved, Investigational Nutra Target 0
Carbon dioxide Approved, Investigational, Vet_approved Pharma 0
Pyridoxal Phosphate Approved, Investigational Nutra 22
Pyruvic acid Approved, Investigational Nutra 0
Phosphatidylethanolamine Experimental Pharma 0

(508) Additional Compounds for PISD Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
PE(P-16:0e/16:0)
  • 1-(Hexadec-1-enyl)-2-palmitoyl-sn-glycero-3-phosphoethanolamine zwitterion
  • 1-[(1Z)-Hexadec-1-enyl]-2-hexadecanoyl-sn-glycero-3-phosphoethanolamine zwitterion
  • 1-[(1Z)-Hexadec-1-enyl]-2-palmitoyl-sn-glycero-3-phosphoethanolamine zwitterion
  • PE(P-16:0/16:0)
  • 2-Hexadecanoyl-1-(1Z-hexadecenyl)-sn-glycero-3-phosphoethanolamine
PEP-16:0/18:1(11Z))
  • 1-(1-Enyl-palmitoyl)-2-vaccenoyl-sn-glycero-3-phosphoethanolamine
  • GPEtn(16:0/18:1)
  • GPEtn(16:0/18:1n7)
  • GPEtn(16:0/18:1W7)
  • GPEtn(34:1)
Phosphatidylethanolamines Group A
  • 1-(1Z-Octadecenyl)-2-(5Z,8Z,11Z,14Z- eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine
  • 1-(1Z-Octadecenyl)-2-(5Z,8Z,11Z,14Z-icosatetraenoyl)-sn-glycero-3-phosphoethanolamine zwitterion
  • 1-(1-Enyl-stearoyl)-2-arachidonoyl-sn-glycero-3-phosphoethanolamine
  • 1-(1Z-Octadecenyl)-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphoethanolamine
  • 1-Alkenyl-2-acyl-glycerophosphoethanolamine
103597-60-0, 998-07-2, 923-61-5, 1069-79-0
Phosphatidylethanolamines Group B
  • Glycerophosphoethanolamine
  • Glycerophosphoethanolamine(P-16:0E/0:0)
  • PE(0:0)
  • GPEtn(0:0)
  • Phophatidylethanolamine(0:0)
Phosphatidylinositol-3,4,5-trisphosphate
  • 1,2-Diacyl-sn-glycero-3-phospho-(1'-myo-inositol-3',4',5'-bisphosphate)
  • 1-Phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate
genes like me logo Genes that share compounds with PISD: view

Transcripts for PISD Gene

Unigene Clusters for PISD Gene

Phosphatidylserine decarboxylase:
Representative Sequences:

CRISPR Products

Clone Products

  • Applied Biological Materials (abm): Clones for PISD - Now 50% OFF >
  • * PISD as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
  • * PISD tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All

Alternative Splicing Database (ASD) splice patterns (SP) for PISD Gene

No ASD Table

Relevant External Links for PISD Gene

GeneLoc Exon Structure for
PISD
ECgene alternative splicing isoforms for
PISD

Expression for PISD Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PISD Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for PISD Gene

This gene is overexpressed in Whole Blood (x5.4).

Protein differential expression in normal tissues from HIPED for PISD Gene

This gene is overexpressed in Bone (28.9), Placenta (9.4), Monocytes (7.8), and Peripheral blood mononuclear cells (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for PISD Gene



Protein tissue co-expression partners for PISD Gene

NURSA nuclear receptor signaling pathways regulating expression of PISD Gene:

PISD

SOURCE GeneReport for Unigene cluster for PISD Gene:

Hs.420559

Evidence on tissue expression from TISSUES for PISD Gene

  • Nervous system(4.7)
  • Kidney(4.2)
  • Lung(2.2)
genes like me logo Genes that share expression patterns with PISD: view

No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PISD Gene

Orthologs for PISD Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PISD Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PISD 35 34
  • 99.38 (n)
OneToOne
dog
(Canis familiaris)
Mammalia PISD 35 34
  • 90.29 (n)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PISD 35
  • 90 (a)
OneToOne
cow
(Bos Taurus)
Mammalia PISD 35 34
  • 89.41 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Pisd 34
  • 86.87 (n)
mouse
(Mus musculus)
Mammalia Pisd 17 34
  • 86.53 (n)
AC149090.1 35
  • 77 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia PISD 35
  • 63 (a)
OneToOne
chicken
(Gallus gallus)
Aves PISD 35 34
  • 77.17 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia PISD 35
  • 49 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pisd 34
  • 73.43 (n)
Str.13223 34
African clawed frog
(Xenopus laevis)
Amphibia MGC52759 34
zebrafish
(Danio rerio)
Actinopterygii pisd 35 34
  • 72.64 (n)
OneToOne
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.10562 34
fruit fly
(Drosophila melanogaster)
Insecta CG5991 35 34
  • 56.05 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP001235 34
  • 55.05 (n)
worm
(Caenorhabditis elegans)
Secernentea psd-1 35 34
  • 48.61 (n)
OneToOne
B0361.5 36
  • 39 (a)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AFR022C 34
  • 52.13 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0D08096g 34
  • 50.62 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PSD1 35 34
  • 49.1 (n)
OneToOne
PSD2 37
thale cress
(Arabidopsis thaliana)
eudicotyledons PSD1 34
  • 51.79 (n)
rice
(Oryza sativa)
Liliopsida Os03g0101900 34
  • 49.01 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU03695 34
  • 51.68 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes psd2 34
  • 49.21 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 43 (a)
OneToOne
Species where no ortholog for PISD was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PISD Gene

ENSEMBL:
Gene Tree for PISD (if available)
TreeFam:
Gene Tree for PISD (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PISD: view image

Paralogs for PISD Gene

No data available for Paralogs for PISD Gene

Variants for PISD Gene

Sequence variations from dbSNP and Humsavar for PISD Gene

SNP ID Clin Chr 22 pos Variation AA Info Type
rs863223357 benign, Childhood-Onset Schizophrenia 31,625,771(-) C/T coding_sequence_variant, intron_variant, synonymous_variant
rs1000008618 -- 31,650,325(-) C/A genic_upstream_transcript_variant, intron_variant
rs1000062272 -- 31,644,966(-) T/C genic_upstream_transcript_variant, intron_variant
rs1000120985 -- 31,624,089(-) C/T intron_variant
rs1000193756 -- 31,650,723(-) G/C 5_prime_UTR_variant, coding_sequence_variant, genic_upstream_transcript_variant, intron_variant, missense_variant

Structural Variations from Database of Genomic Variants (DGV) for PISD Gene

Variant ID Type Subtype PubMed ID
nsv1110864 OTHER inversion 24896259
nsv517534 CNV loss 19592680
nsv829176 CNV loss 20364138
nsv953070 CNV deletion 24416366

Variation tolerance for PISD Gene

Residual Variation Intolerance Score: 68.7% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.02; 50.06% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PISD Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PISD

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PISD Gene

Disorders for PISD Gene

Additional Disease Information for PISD

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for PISD Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PISD Gene

Publications for PISD Gene

  1. The DNA sequence of human chromosome 22. (PMID: 10591208) Dunham I … O'Brien KP (Nature 1999) 2 3 4 58
  2. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 45 58
  3. Phosphatidylserine decarboxylases, key enzymes of lipid metabolism. (PMID: 19165886) Schuiki I … Daum G (IUBMB life 2009) 3 23 58
  4. High-throughput mass spectrometry screening for inhibitors of phosphatidylserine decarboxylase. (PMID: 17478478) Forbes CD … Lumb KJ (Journal of biomolecular screening 2007) 3 23 58
  5. A genome annotation-driven approach to cloning the human ORFeome. (PMID: 15461802) Collins JE … Dunham I (Genome biology 2004) 3 4 58

Products for PISD Gene