Aliases for PIP5K1A Gene

Aliases for PIP5K1A Gene

  • Phosphatidylinositol-4-Phosphate 5-Kinase Type 1 Alpha 2 3 5
  • 68 KDa Type I Phosphatidylinositol 4-Phosphate 5-Kinase Alpha 3 4
  • Phosphatidylinositol 4-Phosphate 5-Kinase Type I Alpha 3 4
  • Phosphatidylinositol 4-Phosphate 5-Kinase Type-1 Alpha 3 4
  • PtdIns(4)P-5-Kinase 1 Alpha 3 4
  • PIP5K1-Alpha 3 4
  • PIP5KIalpha 3 4
  • EC 2.7.1.68 4 52
  • Phosphatidylinositol-4-Phosphate 5-Kinase, Type I, Alpha 2
  • EC 2.7.1 52

External Ids for PIP5K1A Gene

Previous GeneCards Identifiers for PIP5K1A Gene

  • GC01P149012
  • GC01P146918
  • GC01P147946
  • GC01P148387
  • GC01P147984
  • GC01P149437
  • GC01P122549

Summaries for PIP5K1A Gene

GeneCards Summary for PIP5K1A Gene

PIP5K1A (Phosphatidylinositol-4-Phosphate 5-Kinase Type 1 Alpha) is a Protein Coding gene. Among its related pathways are Downstream signaling events of B Cell Receptor (BCR) and Immune response Role of DAP12 receptors in NK cells. Gene Ontology (GO) annotations related to this gene include kinase binding and 1-phosphatidylinositol-4-phosphate 5-kinase activity. An important paralog of this gene is PIP5K1C.

UniProtKB/Swiss-Prot Summary for PIP5K1A Gene

  • Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety of cellular processes and is the substrate to form phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3), another second messenger. The majority of PtdIns(4,5)P2 is thought to occur via type I phosphatidylinositol 4-phosphate 5-kinases given the abundance of PtdIns4P. Participates in a variety of cellular processes such as actin cytoskeleton organization, cell adhesion, migration and phagocytosis. Required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of RAC1 to the plasma membrane. Together with PIP5K1C is required for phagocytosis, but they regulate different types of actin remodeling at sequential steps. Promotes particle ingestion by activating WAS that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup. Together with PIP5K1B is required after stimulation of G-protein coupled receptors for stable platelet adhesion. Plays a role during calcium-induced keratinocyte differentiation. Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, diacylglycerol and inositol 1,4,5-trisphosphate that mobilize internal calcium and drive keratinocyte differentiation. Together with PIP5K1C have a role during embryogenesis. Functions also in the nucleus where acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs (PubMed:18288197, PubMed:19158393, PubMed:20660631). Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (By similarity).

Gene Wiki entry for PIP5K1A Gene

Additional gene information for PIP5K1A Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PIP5K1A Gene

Genomics for PIP5K1A Gene

GeneHancer (GH) Regulatory Elements for PIP5K1A Gene

Promoters and enhancers for PIP5K1A Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PIP5K1A on UCSC Golden Path with GeneCards custom track

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PIP5K1A

Top Transcription factor binding sites by QIAGEN in the PIP5K1A gene promoter:
  • C/EBPalpha
  • FOXO3
  • FOXO3a
  • FOXO3b
  • HOXA5
  • MAZR
  • Pax-4a
  • RSRFC4
  • SEF-1 (1)
  • Sp1

Genomic Locations for PIP5K1A Gene

Genomic Locations for PIP5K1A Gene
chr1:151,197,949-151,249,536
(GRCh38/hg38)
Size:
51,588 bases
Orientation:
Plus strand
chr1:151,170,425-151,222,012
(GRCh37/hg19)
Size:
51,588 bases
Orientation:
Plus strand

Genomic View for PIP5K1A Gene

Genes around PIP5K1A on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PIP5K1A Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PIP5K1A Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PIP5K1A Gene

Proteins for PIP5K1A Gene

  • Protein details for PIP5K1A Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q99755-PI51A_HUMAN
    Recommended name:
    Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
    Protein Accession:
    Q99755
    Secondary Accessions:
    • A8K4Q0
    • B4DIN0
    • Q99754
    • Q99756

    Protein attributes for PIP5K1A Gene

    Size:
    562 amino acids
    Molecular mass:
    62633 Da
    Quaternary structure:
    • Interacts with RAC1 (By similarity). Interacts with TUT1. Forms a complex with CDH1/E-cadherin, CTNNB1/beta-catenin and CTNND1 at the plasma membrane upon calcium stimulation (PubMed:18288197, PubMed:19158393). Found in a ternary complex with IRS1 and DGKZ in the absence of insulin stimulation (By similarity). Interacts with DGKZ (PubMed:15157668).

    Alternative splice isoforms for PIP5K1A Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PIP5K1A Gene

Selected DME Specific Peptides for PIP5K1A Gene

Q99755:
  • RDVLMQDFYVVES
  • IMDYSLL
  • KTLQRDC
  • GIIDILQ
  • QKALYSTA
  • DGDTVSVHRP
  • PTFKDLDFLQD
  • DFRFKTYAP
  • HKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYC
  • NIRIVVMNN
  • PSEGSNLTPAHH
  • KKLEHSWKALV
  • DLKGSTYKRRAS
  • AFRYFRELFGI
  • LYSTAMESIQG

Post-translational modifications for PIP5K1A Gene

  • Ubiquitination at Lys103
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Boster Bio Antibodies for PIP5K1A

Domains & Families for PIP5K1A Gene

Gene Families for PIP5K1A Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for PIP5K1A Gene

Blocks:
  • Phosphatidylinositol-4-phosphate 5-kinase
InterPro:
ProtoNet:

Suggested Antigen Peptide Sequences for PIP5K1A Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ59099, highly similar to Phosphatidylinositol-4-phosphate 5-kinase type-1 alpha (EC 2.7.1.68) (B4DY52_HUMAN)
  • Phosphatidylinositol-4-phosphate 5-kinase type I alpha (PI51A_HUMAN)
genes like me logo Genes that share domains with PIP5K1A: view

No data available for Graphical View of Domain Structure and UniProtKB/Swiss-Prot for PIP5K1A Gene

Function for PIP5K1A Gene

Molecular function for PIP5K1A Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety of cellular processes and is the substrate to form phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3), another second messenger. The majority of PtdIns(4,5)P2 is thought to occur via type I phosphatidylinositol 4-phosphate 5-kinases given the abundance of PtdIns4P. Participates in a variety of cellular processes such as actin cytoskeleton organization, cell adhesion, migration and phagocytosis. Required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of RAC1 to the plasma membrane. Together with PIP5K1C is required for phagocytosis, but they regulate different types of actin remodeling at sequential steps. Promotes particle ingestion by activating WAS that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup. Together with PIP5K1B is required after stimulation of G-protein coupled receptors for stable platelet adhesion. Plays a role during calcium-induced keratinocyte differentiation. Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, diacylglycerol and inositol 1,4,5-trisphosphate that mobilize internal calcium and drive keratinocyte differentiation. Together with PIP5K1C have a role during embryogenesis. Functions also in the nucleus where acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs (PubMed:18288197, PubMed:19158393, PubMed:20660631). Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (By similarity).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+); Xref=Rhea:RHEA:14425, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:58178, ChEBI:CHEBI:58456, ChEBI:CHEBI:456216; EC=2.7.1.68;.
GENATLAS Biochemistry:
phosphatidylinositol-4-phosphate-5 kinase,type 1 alpha,widely expressed,noteworthy in erythrocytes,activated by the small G protein ADP-ribosylation factor ARF6,and putatively involved in membrane ruffle formation

Enzyme Numbers (IUBMB) for PIP5K1A Gene

Phenotypes From GWAS Catalog for PIP5K1A Gene

Gene Ontology (GO) - Molecular Function for PIP5K1A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005515 protein binding IPI 15157668
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
GO:0016307 phosphatidylinositol phosphate kinase activity IEA --
GO:0016308 1-phosphatidylinositol-4-phosphate 5-kinase activity TAS 18305108
genes like me logo Genes that share ontologies with PIP5K1A: view
genes like me logo Genes that share phenotypes with PIP5K1A: view

Animal Models for PIP5K1A Gene

MGI Knock Outs for PIP5K1A:

Animal Model Products

  • Taconic Biosciences Mouse Models for PIP5K1A

CRISPR Products

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PIP5K1A Gene

Localization for PIP5K1A Gene

Subcellular locations from UniProtKB/Swiss-Prot for PIP5K1A Gene

Cell membrane. Cytoplasm. Nucleus speckle. Cell projection, ruffle. Cell projection, lamellipodium. Nucleus. Note=Colocalizes with RAC1 at actin-rich membrane ruffles. Localizes to nuclear speckles and associates with TUT1 to regulate polyadenylation of selected mRNAs.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PIP5K1A gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 5
cytoskeleton 2
extracellular 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleoplasm (3)
  • Plasma membrane (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PIP5K1A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001726 ruffle IEA --
GO:0005634 nucleus IDA,IEA 15157668
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol IEA,TAS --
genes like me logo Genes that share ontologies with PIP5K1A: view

Pathways & Interactions for PIP5K1A Gene

genes like me logo Genes that share pathways with PIP5K1A: view

Pathways by source for PIP5K1A Gene

4 GeneGo (Thomson Reuters) pathways for PIP5K1A Gene
  • G-protein signaling RAC1 in cellular process
  • Immune response CD16 signaling in NK cells
  • Immune response CD28 signaling
  • Inhibitory action of Lipoxins on neutrophil migration
7 Qiagen pathways for PIP5K1A Gene
  • Actin-Based Motility by Rho Family GTPases
  • Aldosterone Signaling in Epithelial Cells
  • Fc-GammaR-Mediated Phagocytosis in Macrophages
  • Integrin Pathway
  • Rac1 Pathway
1 Cell Signaling Technology pathway for PIP5K1A Gene

SIGNOR curated interactions for PIP5K1A Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for PIP5K1A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006650 glycerophospholipid metabolic process TAS 8955136
GO:0006661 phosphatidylinositol biosynthetic process IEA,TAS --
GO:0006909 phagocytosis TAS 19889969
GO:0007165 signal transduction TAS 8955136
GO:0008654 phospholipid biosynthetic process IDA 15157668
genes like me logo Genes that share ontologies with PIP5K1A: view

Drugs & Compounds for PIP5K1A Gene

(3) Additional Compounds for PIP5K1A Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with PIP5K1A: view

Transcripts for PIP5K1A Gene

mRNA/cDNA for PIP5K1A Gene

5 REFSEQ mRNAs :
12 NCBI additional mRNA sequence :
17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PIP5K1A Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10a · 10b · 10c ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b
SP1: - -
SP2:
SP3:
SP4: -
SP5:
SP6: -
SP7:

Relevant External Links for PIP5K1A Gene

GeneLoc Exon Structure for
PIP5K1A

Expression for PIP5K1A Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PIP5K1A Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PIP5K1A Gene

This gene is overexpressed in Placenta (16.0), Frontal cortex (14.0), Testis (12.3), and Plasma (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PIP5K1A Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PIP5K1A

SOURCE GeneReport for Unigene cluster for PIP5K1A Gene:

Hs.655131

mRNA Expression by UniProt/SwissProt for PIP5K1A Gene:

Q99755-PI51A_HUMAN
Tissue specificity: Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in brain, lung and liver.

Evidence on tissue expression from TISSUES for PIP5K1A Gene

  • Nervous system(4.8)
  • Muscle(4.3)
genes like me logo Genes that share expression patterns with PIP5K1A: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PIP5K1A Gene

Orthologs for PIP5K1A Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PIP5K1A Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PIP5K1A 31 30
  • 99.81 (n)
OneToOne
dog
(Canis familiaris)
Mammalia PIP5K1A 31 30
  • 91.84 (n)
OneToOne
cow
(Bos Taurus)
Mammalia PIP5K1A 31 30
  • 89.6 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Pip5k1a 30
  • 87.36 (n)
mouse
(Mus musculus)
Mammalia Pip5k1a 17 31 30
  • 87.3 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 31
  • 76 (a)
ManyToMany
oppossum
(Monodelphis domestica)
Mammalia PIP5K1A 31
  • 44 (a)
OneToOne
chicken
(Gallus gallus)
Aves LOC100857846 30
  • 74.65 (n)
PIP5K1A 31 31
  • 67 (a)
OneToMany
lizard
(Anolis carolinensis)
Reptilia PIP5K1A 31
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pip5k1a 30
  • 71.49 (n)
Str.20508 30
zebrafish
(Danio rerio)
Actinopterygii pip5k1ab 31 30
  • 67.37 (n)
OneToMany
pip5k1aa 31
  • 58 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta PIP5K59B 31 30
  • 62.33 (n)
ManyToMany
sktl 31 32
  • 36 (a)
ManyToMany
worm
(Caenorhabditis elegans)
Secernentea ppk-1 31 32 30
  • 56.69 (n)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes MSS4 31
  • 22 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 31
  • 70 (a)
OneToMany
Cin.7172 30
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.7172 30
Species where no ortholog for PIP5K1A was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PIP5K1A Gene

ENSEMBL:
Gene Tree for PIP5K1A (if available)
TreeFam:
Gene Tree for PIP5K1A (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PIP5K1A: view image

Paralogs for PIP5K1A Gene

Paralogs for PIP5K1A Gene

(7) SIMAP similar genes for PIP5K1A Gene using alignment to 7 proteins:

  • PI51A_HUMAN
  • A2A5X0_HUMAN
  • A6PW56_HUMAN
  • A6PW57_HUMAN
  • A6PW58_HUMAN
  • B4DY52_HUMAN
  • E9PSF8_HUMAN

Pseudogenes.org Pseudogenes for PIP5K1A Gene