Aliases for PIP5K1A Gene

Aliases for PIP5K1A Gene

  • Phosphatidylinositol-4-Phosphate 5-Kinase Type 1 Alpha 2 3 5
  • 68 KDa Type I Phosphatidylinositol 4-Phosphate 5-Kinase Alpha 3 4
  • Phosphatidylinositol 4-Phosphate 5-Kinase Type-1 Alpha 3 4
  • Phosphatidylinositol 4-Phosphate 5-Kinase Type I Alpha 3 4
  • PtdIns(4)P-5-Kinase 1 Alpha 3 4
  • PIP5K1-Alpha 3 4
  • PIP5KIalpha 3 4
  • EC 2.7.1.68 4 50
  • Phosphatidylinositol-4-Phosphate 5-Kinase, Type I, Alpha 2
  • EC 2.7.1 50
  • PIP5K1A 5

External Ids for PIP5K1A Gene

Previous GeneCards Identifiers for PIP5K1A Gene

  • GC01P149012
  • GC01P146918
  • GC01P147946
  • GC01P148387
  • GC01P147984
  • GC01P149437
  • GC01P151170
  • GC01P122549

Summaries for PIP5K1A Gene

GeneCards Summary for PIP5K1A Gene

PIP5K1A (Phosphatidylinositol-4-Phosphate 5-Kinase Type 1 Alpha) is a Protein Coding gene. Among its related pathways are RET signaling and Integrin Pathway. Gene Ontology (GO) annotations related to this gene include kinase binding and 1-phosphatidylinositol-4-phosphate 5-kinase activity. An important paralog of this gene is PIP5K1C.

UniProtKB/Swiss-Prot Summary for PIP5K1A Gene

  • Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns(4)P/PI4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2/PIP2), a lipid second messenger that regulates several cellular processes such as signal transduction, vesicle trafficking, actin cytoskeleton dynamics, cell adhesion, and cell motility (PubMed:8955136, PubMed:21477596, PubMed:22942276). PtdIns(4,5)P2 can directly act as a second messenger or can be utilized as a precursor to generate other second messengers: inositol 1,4,5-trisphosphate (IP3), diacylglycerol (DAG) or phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3/PIP3) (PubMed:19158393, PubMed:20660631). PIP5K1A-mediated phosphorylation of PtdIns(4)P is the predominant pathway for PtdIns(4,5)P2 synthesis (By similarity). Can also use phosphatidylinositol (PtdIns) as substrate in vitro (PubMed:22942276). Together with PIP5K1C, is required for phagocytosis, both enzymes regulating different types of actin remodeling at sequential steps (By similarity). Promotes particle ingestion by activating the WAS GTPase-binding protein that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup (By similarity). Together with PIP5K1B, is required, after stimulation by G-protein coupled receptors, for the synthesis of IP3 that will induce stable platelet adhesion (By similarity). Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, IP3 and DAG, that will mobilize internal calcium and drive keratinocyte differentiation (PubMed:19158393). Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (By similarity). Together with PIP5K1C has a role during embryogenesis (By similarity). Independently of its catalytic activity, is required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of the small GTPase RAC1 to the plasma membrane (PubMed:20660631). Also functions in the nucleus where it acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs (PubMed:18288197).

Gene Wiki entry for PIP5K1A Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PIP5K1A Gene

Genomics for PIP5K1A Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PIP5K1A Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PIP5K1A on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PIP5K1A

Top Transcription factor binding sites by QIAGEN in the PIP5K1A gene promoter:
  • C/EBPalpha
  • FOXO3
  • FOXO3a
  • FOXO3b
  • HOXA5
  • MAZR
  • Pax-4a
  • RSRFC4
  • SEF-1 (1)
  • Sp1

Genomic Locations for PIP5K1A Gene

Latest Assembly
chr1:151,197,949-151,249,536
(GRCh38/hg38)
Size:
51,588 bases
Orientation:
Plus strand

Previous Assembly
chr1:151,171,028-151,222,007
(GRCh37/hg19 by Entrez Gene)
Size:
50,980 bases
Orientation:
Plus strand

chr1:151,170,425-151,222,012
(GRCh37/hg19 by Ensembl)
Size:
51,588 bases
Orientation:
Plus strand

Genomic View for PIP5K1A Gene

Genes around PIP5K1A on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PIP5K1A Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PIP5K1A Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PIP5K1A Gene

Proteins for PIP5K1A Gene

  • Protein details for PIP5K1A Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q99755-PI51A_HUMAN
    Recommended name:
    Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
    Protein Accession:
    Q99755
    Secondary Accessions:
    • A8K4Q0
    • B4DIN0
    • Q99754
    • Q99756

    Protein attributes for PIP5K1A Gene

    Size:
    562 amino acids
    Molecular mass:
    62633 Da
    Quaternary structure:
    • Interacts with RAC1 (By similarity). Interacts with TUT1 (PubMed:18288197). Forms a complex with CDH1/E-cadherin, CTNNB1/beta-catenin and CTNND1 at the plasma membrane upon calcium stimulation (PubMed:18288197). Found in a ternary complex with IRS1 and DGKZ in the absence of insulin stimulation (By similarity). Interacts with DGKZ (PubMed:15157668). Interacts with PIP4K2C; the interaction inhibits PIP5K1A kinase activity (PubMed:31091439).

    Alternative splice isoforms for PIP5K1A Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PIP5K1A Gene

Selected DME Specific Peptides for PIP5K1A Gene

Q99755:
  • RDVLMQDFYVVES
  • IMDYSLL
  • KTLQRDC
  • GIIDILQ
  • QKALYSTA
  • DGDTVSVHRP
  • PTFKDLDFLQD
  • DFRFKTYAP
  • HKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYC
  • NIRIVVMNN
  • PSEGSNLTPAHH
  • KKLEHSWKALV
  • DLKGSTYKRRAS
  • AFRYFRELFGI
  • LYSTAMESIQG

Post-translational modifications for PIP5K1A Gene

  • Ubiquitination at Lys103
  • Modification sites at PhosphoSitePlus

Domains & Families for PIP5K1A Gene

Gene Families for PIP5K1A Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for PIP5K1A Gene

InterPro:
Blocks:
  • Phosphatidylinositol-4-phosphate 5-kinase

Suggested Antigen Peptide Sequences for PIP5K1A Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ59099, highly similar to Phosphatidylinositol-4-phosphate 5-kinase type-1 alpha (EC 2.7.1.68) (B4DY52_HUMAN)
  • Phosphatidylinositol-4-phosphate 5-kinase type I alpha (PI51A_HUMAN)
genes like me logo Genes that share domains with PIP5K1A: view

No data available for Graphical View of Domain Structure and UniProtKB/Swiss-Prot for PIP5K1A Gene

Function for PIP5K1A Gene

Molecular function for PIP5K1A Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns(4)P/PI4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2/PIP2), a lipid second messenger that regulates several cellular processes such as signal transduction, vesicle trafficking, actin cytoskeleton dynamics, cell adhesion, and cell motility (PubMed:8955136, PubMed:21477596, PubMed:22942276). PtdIns(4,5)P2 can directly act as a second messenger or can be utilized as a precursor to generate other second messengers: inositol 1,4,5-trisphosphate (IP3), diacylglycerol (DAG) or phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3/PIP3) (PubMed:19158393, PubMed:20660631). PIP5K1A-mediated phosphorylation of PtdIns(4)P is the predominant pathway for PtdIns(4,5)P2 synthesis (By similarity). Can also use phosphatidylinositol (PtdIns) as substrate in vitro (PubMed:22942276). Together with PIP5K1C, is required for phagocytosis, both enzymes regulating different types of actin remodeling at sequential steps (By similarity). Promotes particle ingestion by activating the WAS GTPase-binding protein that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup (By similarity). Together with PIP5K1B, is required, after stimulation by G-protein coupled receptors, for the synthesis of IP3 that will induce stable platelet adhesion (By similarity). Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, IP3 and DAG, that will mobilize internal calcium and drive keratinocyte differentiation (PubMed:19158393). Positively regulates insulin-induced translocation of SLC2A4 to the cell membrane in adipocytes (By similarity). Together with PIP5K1C has a role during embryogenesis (By similarity). Independently of its catalytic activity, is required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of the small GTPase RAC1 to the plasma membrane (PubMed:20660631). Also functions in the nucleus where it acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs (PubMed:18288197).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+); Xref=Rhea:RHEA:14425, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:58178, ChEBI:CHEBI:58456, ChEBI:CHEBI:456216; EC=2.7.1.68; Evidence={ECO:0000269|PubMed:21477596, ECO:0000269|PubMed:22942276, ECO:0000269|PubMed:31091439, ECO:0000269|PubMed:8955136};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate + ATP = 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4,5-bisphosphate + ADP + H(+); Xref=Rhea:RHEA:40363, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:77136, ChEBI:CHEBI:77137, ChEBI:CHEBI:456216; Evidence={ECO:0000269|PubMed:21477596, ECO:0000269|PubMed:22942276};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2-dihexadecanoyl-sn-glycero-3-phospho-(1D-myo-inositol-4-phosphate) + ATP = 1,2-dihexadecanoyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+); Xref=Rhea:RHEA:65356, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:83423, ChEBI:CHEBI:83436, ChEBI:CHEBI:456216; Evidence={ECO:0000269|PubMed:21477596};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-octadecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate + ATP = 1-octadecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phospho-1D-myo-inositol 4,5-bisphosphate + ADP + H(+); Xref=Rhea:RHEA:40367, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:77139, ChEBI:CHEBI:77140, ChEBI:CHEBI:456216; Evidence={ECO:0000269|PubMed:22942276};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-octadecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phospho-1D-myo-inositol + ATP = 1-octadecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phospho-1D-myo-inositol 5-phosphate + ADP + H(+); Xref=Rhea:RHEA:40379, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:77163, ChEBI:CHEBI:77164, ChEBI:CHEBI:456216; Evidence={ECO:0000269|PubMed:22942276};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-octadecanoyl-2-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phospho-1D-myo-inositol + ATP = 1-octadecanoyl-2-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phospho-1D-myo-inositol 5-phosphate + ADP + H(+); Xref=Rhea:RHEA:40383, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:77158, ChEBI:CHEBI:77159, ChEBI:CHEBI:456216; Evidence={ECO:0000269|PubMed:22942276};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1-octadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 5-phosphate + ADP + H(+); Xref=Rhea:RHEA:40375, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:77160, ChEBI:CHEBI:133606, ChEBI:CHEBI:456216; Evidence={ECO:0000269|PubMed:22942276};.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=1,2-di-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phospho-1D-myo-inositol + ATP = 1,2-di(9Z,12Z)-octadecadienoyl-sn-glycero-3-phospho-1D-myo-inositol 5-phosphate + ADP + H(+); Xref=Rhea:RHEA:40387, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:77165, ChEBI:CHEBI:77167, ChEBI:CHEBI:456216; Evidence={ECO:0000269|PubMed:22942276};.
UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=0.3 uM for 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate {ECO:0000269|PubMed:21477596}; KM=2.8 uM for 1-octadecanoyl-2-(5Z,8Z,11Z,14Z)-eicosatetraenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate {ECO:0000269|PubMed:22942276}; KM=16 uM for 1-octadecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phospho-1D-myo-inositol 4-phosphate {ECO:0000269|PubMed:22942276};
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by diarachidonoyl phosphatidic acid (DAPA), when 1,2-dipalmitoyl-PI4P is used as a substrate.
GENATLAS Biochemistry:
phosphatidylinositol-4-phosphate-5 kinase,type 1 alpha,widely expressed,noteworthy in erythrocytes,activated by the small G protein ADP-ribosylation factor ARF6,and putatively involved in membrane ruffle formation

Enzyme Numbers (IUBMB) for PIP5K1A Gene

Phenotypes From GWAS Catalog for PIP5K1A Gene

Gene Ontology (GO) - Molecular Function for PIP5K1A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0005515 protein binding IPI 15157668
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
GO:0016307 phosphatidylinositol phosphate kinase activity IEA --
genes like me logo Genes that share ontologies with PIP5K1A: view
genes like me logo Genes that share phenotypes with PIP5K1A: view

Animal Models for PIP5K1A Gene

MGI Knock Outs for PIP5K1A:

Animal Models for research

  • Taconic Biosciences Mouse Models for PIP5K1A

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PIP5K1A

Clone products for research

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PIP5K1A Gene

Localization for PIP5K1A Gene

Subcellular locations from UniProtKB/Swiss-Prot for PIP5K1A Gene

Cell membrane. Cytoplasm. Nucleus. Nucleus speckle. Cell projection, ruffle. Cell projection, lamellipodium. Note=Colocalizes with RAC1 at actin-rich membrane ruffles (PubMed:20660631). Localizes to nuclear speckles and associates with TUT1 to regulate polyadenylation of selected mRNAs (PubMed:18288197). {ECO:0000269 PubMed:18288197, ECO:0000269 PubMed:20660631}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PIP5K1A gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 5
cytoskeleton 2
extracellular 1
mitochondrion 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleoplasm (3)
  • Plasma membrane (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PIP5K1A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001726 ruffle IEA --
GO:0005634 nucleus IEA,IDA 15157668
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol IEA,TAS --
genes like me logo Genes that share ontologies with PIP5K1A: view

Pathways & Interactions for PIP5K1A Gene

genes like me logo Genes that share pathways with PIP5K1A: view

Pathways by source for PIP5K1A Gene

4 GeneGo (Thomson Reuters) pathways for PIP5K1A Gene
  • G-protein signaling RAC1 in cellular process
  • Immune response CD16 signaling in NK cells
  • Immune response CD28 signaling
  • Inhibitory action of Lipoxins on neutrophil migration
7 Qiagen pathways for PIP5K1A Gene
  • Actin-Based Motility by Rho Family GTPases
  • Aldosterone Signaling in Epithelial Cells
  • Fc-GammaR-Mediated Phagocytosis in Macrophages
  • Integrin Pathway
  • Rac1 Pathway
1 Cell Signaling Technology pathway for PIP5K1A Gene

SIGNOR curated interactions for PIP5K1A Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for PIP5K1A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006650 glycerophospholipid metabolic process TAS 8955136
GO:0006661 phosphatidylinositol biosynthetic process IEA,TAS --
GO:0006909 phagocytosis TAS 19889969
GO:0007165 signal transduction TAS 8955136
GO:0008654 phospholipid biosynthetic process IDA 15157668
genes like me logo Genes that share ontologies with PIP5K1A: view

Drugs & Compounds for PIP5K1A Gene

(3) Additional Compounds for PIP5K1A Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with PIP5K1A: view

Transcripts for PIP5K1A Gene

mRNA/cDNA for PIP5K1A Gene

5 REFSEQ mRNAs :
12 NCBI additional mRNA sequence :
17 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PIP5K1A

Clone products for research

Alternative Splicing Database (ASD) splice patterns (SP) for PIP5K1A Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10a · 10b · 10c ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b
SP1: - -
SP2:
SP3:
SP4: -
SP5:
SP6: -
SP7:

Relevant External Links for PIP5K1A Gene

GeneLoc Exon Structure for
PIP5K1A

Expression for PIP5K1A Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PIP5K1A Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PIP5K1A Gene

This gene is overexpressed in Placenta (16.0), Frontal cortex (14.0), Testis (12.3), and Plasma (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PIP5K1A Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PIP5K1A

SOURCE GeneReport for Unigene cluster for PIP5K1A Gene:

Hs.655131

mRNA Expression by UniProt/SwissProt for PIP5K1A Gene:

Q99755-PI51A_HUMAN
Tissue specificity: Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in brain, lung and liver.

Evidence on tissue expression from TISSUES for PIP5K1A Gene

  • Nervous system(4.9)
  • Muscle(4.4)
genes like me logo Genes that share expression patterns with PIP5K1A: view

Primer products for research

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PIP5K1A Gene

Orthologs for PIP5K1A Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PIP5K1A Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PIP5K1A 29 30
  • 99.81 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia PIP5K1A 29 30
  • 91.84 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia PIP5K1A 29 30
  • 89.6 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pip5k1a 29
  • 87.36 (n)
Mouse
(Mus musculus)
Mammalia Pip5k1a 29 16 30
  • 87.3 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia -- 30
  • 76 (a)
ManyToMany
Oppossum
(Monodelphis domestica)
Mammalia PIP5K1A 30
  • 44 (a)
OneToOne
Chicken
(Gallus gallus)
Aves LOC100857846 29
  • 74.65 (n)
PIP5K1A 30 30
  • 67 (a)
OneToMany
Lizard
(Anolis carolinensis)
Reptilia PIP5K1A 30
  • 79 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia pip5k1a 29
  • 71.49 (n)
Str.20508 29
Zebrafish
(Danio rerio)
Actinopterygii pip5k1ab 29 30
  • 67.37 (n)
OneToMany
pip5k1aa 30
  • 58 (a)
OneToMany
Fruit Fly
(Drosophila melanogaster)
Insecta PIP5K59B 29 30
  • 62.33 (n)
ManyToMany
sktl 30 31
  • 36 (a)
ManyToMany
Worm
(Caenorhabditis elegans)
Secernentea ppk-1 29 30 31
  • 56.69 (n)
OneToMany
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes MSS4 30
  • 22 (a)
OneToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 30
  • 70 (a)
OneToMany
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.7172 29
Species where no ortholog for PIP5K1A was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for PIP5K1A Gene

ENSEMBL:
Gene Tree for PIP5K1A (if available)
TreeFam:
Gene Tree for PIP5K1A (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PIP5K1A: view image
Alliance of Genome Resources:
Additional Orthologs for PIP5K1A

Paralogs for PIP5K1A Gene

Paralogs for PIP5K1A Gene

(7) SIMAP similar genes for PIP5K1A Gene using alignment to 7 proteins:

  • PI51A_HUMAN
  • A2A5X0_HUMAN
  • A6PW56_HUMAN
  • A6PW57_HUMAN
  • A6PW58_HUMAN
  • B4DY52_HUMAN
  • E9PSF8_HUMAN

Pseudogenes.org Pseudogenes for PIP5K1A Gene

genes like me logo Genes that share paralogs with PIP5K1A: view

Variants for PIP5K1A Gene

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for PIP5K1A Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for PIP5K1A Gene

Variant ID Type Subtype PubMed ID
dgv2n68 CNV loss 17160897
esv2717840 CNV deletion 23290073
esv3587521 CNV loss 21293372
esv3587522 CNV gain 21293372
nsv522840 CNV gain 19592680

Variation tolerance for PIP5K1A Gene

Residual Variation Intolerance Score: 33% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.72; 32.75% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PIP5K1A Gene

Human Gene Mutation Database (HGMD)
PIP5K1A
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PIP5K1A
Leiden Open Variation Database (LOVD)
PIP5K1A

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PIP5K1A Gene

Disorders for PIP5K1A Gene

Additional Disease Information for PIP5K1A

No disorders were found for PIP5K1A Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PIP5K1A Gene

Publications for PIP5K1A Gene

  1. Type I phosphatidylinositol-4-phosphate 5-kinases are distinct members of this novel lipid kinase family. (PMID: 8955136) Loijens JC … Anderson RA (The Journal of biological chemistry 1996) 2 3 4 22
  2. Assignment of type I phosphatidylinositol-4-phosphate 5-kinase (PIP5K1A) to human chromosome bands 1q22--> q24 by in situ hybridization. (PMID: 10828584) Xie Y … Zhao G (Cytogenetics and cell genetics 2000) 2 3 22
  3. PIP4Ks Suppress Insulin Signaling through a Catalytic-Independent Mechanism. (PMID: 31091439) Wang DG … Cantley LC (Cell reports 2019) 3 4
  4. Phosphatidylinositol-4-phosphate 5-kinase isoforms exhibit acyl chain selectivity for both substrate and lipid activator. (PMID: 22942276) Shulga YV … Epand RM (The Journal of biological chemistry 2012) 3 4
  5. Study of arachidonoyl specificity in two enzymes of the PI cycle. (PMID: 21477596) Shulga YV … Epand RM (Journal of molecular biology 2011) 3 4

Products for PIP5K1A Gene

Sources for PIP5K1A Gene