Aliases for PI4KB Gene

Aliases for PI4KB Gene

  • Phosphatidylinositol 4-Kinase Beta 2 3 4 5
  • Phosphatidylinositol 4-Kinase, Catalytic, Beta 2 3
  • PtdIns 4-Kinase Beta 3 4
  • EC 2.7.1.67 4 51
  • PI4K-BETA 2 3
  • PI4KIII 3 4
  • PI4K92 3 4
  • PIK4CB 3 4
  • NPIK 3 4
  • Phosphatidylinositol 4-Kinase, Wortmannin-Sensitive 3
  • Type III Phosphatidylinositol 4-Kinase Beta 3
  • PI4KIIIBETA 3
  • PI4K-Beta 4
  • PI4KBETA 3
  • PI4Kbeta 4
  • EC 2.7.1 51
  • Pi4K92 2
  • PI4KB 5

External Ids for PI4KB Gene

Previous HGNC Symbols for PI4KB Gene

  • PIK4CB

Previous GeneCards Identifiers for PI4KB Gene

  • GC01M149532
  • GC01M151264
  • GC01M122642

Summaries for PI4KB Gene

GeneCards Summary for PI4KB Gene

PI4KB (Phosphatidylinositol 4-Kinase Beta) is a Protein Coding gene. Diseases associated with PI4KB include Nonparalytic Poliomyelitis and Polycystic Kidney Disease 3 With Or Without Polycystic Liver Disease. Among its related pathways are Inositol phosphate metabolism (KEGG) and PI Metabolism. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and 1-phosphatidylinositol 4-kinase activity. An important paralog of this gene is PI4KA.

UniProtKB/Swiss-Prot Summary for PI4KB Gene

  • Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking (By similarity).
  • (Microbial infection) Plays an essential role in Aichi virus RNA replication (PubMed:22124328, PubMed:27989622, PubMed:22258260). Recruited by ACBD3 at the viral replication sites (PubMed:22124328, PubMed:27989622).

Gene Wiki entry for PI4KB Gene

Additional gene information for PI4KB Gene

No data available for Entrez Gene Summary , CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PI4KB Gene

Genomics for PI4KB Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PI4KB Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PI4KB on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PI4KB

Top Transcription factor binding sites by QIAGEN in the PI4KB gene promoter:
  • AP-2gamma
  • ATF-2
  • c-Myc
  • C/EBPbeta
  • CP2
  • HFH-3
  • IRF-7A
  • LCR-F1
  • Max1
  • Pax-5

Genomic Locations for PI4KB Gene

Genomic Locations for PI4KB Gene
chr1:151,291,797-151,327,715
(GRCh38/hg38)
Size:
35,919 bases
Orientation:
Minus strand
chr1:151,264,273-151,300,191
(GRCh37/hg19)
Size:
35,919 bases
Orientation:
Minus strand

Genomic View for PI4KB Gene

Genes around PI4KB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PI4KB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PI4KB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PI4KB Gene

Proteins for PI4KB Gene

  • Protein details for PI4KB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UBF8-PI4KB_HUMAN
    Recommended name:
    Phosphatidylinositol 4-kinase beta
    Protein Accession:
    Q9UBF8
    Secondary Accessions:
    • B4DGI2
    • O15096
    • P78405
    • Q5VWB9
    • Q5VWC0
    • Q5VWC1
    • Q9BWR6

    Protein attributes for PI4KB Gene

    Size:
    816 amino acids
    Molecular mass:
    91379 Da
    Quaternary structure:
    • Interacts with ARF1 and ARF3 in the Golgi complex, but not with ARF4, ARF5 or ARF6 (PubMed:17555535). Interacts with NCS1/FREQ in a calcium-independent manner. Interacts with CALN1/CABP8 and CALN2/CABP7; in a calcium-dependent manner; this interaction competes with NCS1/FREQ binding (By similarity). Interacts with ACBD3 (PubMed:23572552, PubMed:27009356, PubMed:27989622, PubMed:22124328, PubMed:22258260). Interacts with ARMH3, YWHAB, YWHAE, YWHAG, YWHAH, YWHAQ, YWHAZ and SFN (PubMed:23572552). Interacts with GGA2 (via VHS domain); the interaction is important for PI4KB location at the Golgi apparatus membrane (PubMed:28289207).
    • (Microbial infection) Interacts with Aichi virus protein 3A. Part of a complex Aichi virus protein 3A/ACBD3/PI4KB that allows the synthesis of PI4P at the viral RNA replication sites.
    SequenceCaution:
    • Sequence=BAA21661.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305}; Sequence=EAW53450.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for PI4KB Gene

    Alternative splice isoforms for PI4KB Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PI4KB Gene

Selected DME Specific Peptides for PI4KB Gene

Q9UBF8:
  • FDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECEN
  • DSEIRCL
  • LSPSKRTHQRSKSDAT
  • LKRTASNPKVE
  • ERVPLWI
  • FIAAGDIRRRLSEQLAHTPT
  • EFVDVMGGL
  • RQNNSAKQSWLLRLFESKLFDISMA
  • IRSTRSVENLP
  • GHIIHIDFGF
  • EKVRRIREGSPYGH
  • PLELVNGDGVD
  • IGKRLATLPTKEQKTQRLISELSLLNHKLPARVWL
  • REFIKSLM
  • QVLKQLQSIWE
  • VEPAPLKP
  • KDRHNGN
  • GDMFNYYKMLMLQGLIAARKHMD
  • EIRCLDDPP
  • TVPNYDNDDEAWSVDDIGELQVELPE
  • GTAKGARR
  • SISLSSNLKRT
  • RCRQSINFSLQCA
  • DSGMIEPVVNAVSIHQVKKQSQL
  • VEIMQQGSQLPCFHGSSTIRNLKERFHM
  • KACQEVL
  • HTNSCDNISQFSVDSITSQESK
  • PNWRLLSVIVKCGDDLRQELLA
  • YFLQEHGS
  • AQRNFVQSCA

Post-translational modifications for PI4KB Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for PI4KB Gene

Gene Families for PI4KB Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for PI4KB Gene

InterPro:
Blocks:
  • Phosphatidylinositol 3- and 4-kinase
ProtoNet:

Suggested Antigen Peptide Sequences for PI4KB Gene

GenScript: Design optimal peptide antigens:
  • Phosphatidylinositol 4-kinase, catalytic, beta (A6PVV8_HUMAN)
  • Phosphatidylinositol 4-kinase, catalytic, beta (A6PVV9_HUMAN)
  • Phosphatidylinositol 4-kinase, catalytic, beta (B7ZBU1_HUMAN)
  • PI4K92 (PI4KB_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9UBF8

UniProtKB/Swiss-Prot:

PI4KB_HUMAN :
  • Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
Family:
  • Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
genes like me logo Genes that share domains with PI4KB: view

Function for PI4KB Gene

Molecular function for PI4KB Gene

UniProtKB/Swiss-Prot Function:
Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking (By similarity).
UniProtKB/Swiss-Prot Function:
(Microbial infection) Plays an essential role in Aichi virus RNA replication (PubMed:22124328, PubMed:27989622, PubMed:22258260). Recruited by ACBD3 at the viral replication sites (PubMed:22124328, PubMed:27989622).
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ADP + H(+); Xref=Rhea:RHEA:19877, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:57880, ChEBI:CHEBI:58178, ChEBI:CHEBI:456216; EC=2.7.1.67; Evidence={ECO:0000269|PubMed:9405935};.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by wortmannin. Increased kinase activity upon interaction with NCS1/FREQ (By similarity).
UniProtKB/Swiss-Prot EnzymeRegulation:
(Microbial infection) Activated by Aichi virus protein 3A, this activation is sensitized by ACBD3.

Enzyme Numbers (IUBMB) for PI4KB Gene

Phenotypes From GWAS Catalog for PI4KB Gene

Gene Ontology (GO) - Molecular Function for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004430 1-phosphatidylinositol 4-kinase activity TAS --
GO:0005515 protein binding IPI 17088255
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with PI4KB: view
genes like me logo Genes that share phenotypes with PI4KB: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PI4KB

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PI4KB

Clone Products

  • Addgene plasmids for PI4KB

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PI4KB Gene

Localization for PI4KB Gene

Subcellular locations from UniProtKB/Swiss-Prot for PI4KB Gene

Endomembrane system. Mitochondrion outer membrane. Peripheral membrane protein. Rough endoplasmic reticulum membrane. Peripheral membrane protein. Golgi apparatus. Golgi apparatus membrane. Cytoplasm, perinuclear region. Note=Found in the outer membrane of mitochondria and membranes of the rough endoplasmic reticulum. Recruited to the Golgi complex by the small GTPase ARF to stimulate the synthesis of phosphatidylinositol 4,5-bisphosphate (PIP2) on the Golgi complex. Recruited to the Golgi apparatus membrane by ACBD3 (PubMed:24672044, PubMed:27009356, PubMed:28289207). GGA2 is also involved in the recruitment (PubMed:28289207). {ECO:0000269 PubMed:24672044, ECO:0000269 PubMed:27009356, ECO:0000269 PubMed:28289207}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PI4KB gene
Compartment Confidence
cytosol 5
golgi apparatus 5
mitochondrion 4
endoplasmic reticulum 4
endosome 4
nucleus 3
plasma membrane 2
cytoskeleton 2
lysosome 2
extracellular 1
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Golgi apparatus (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005737 cytoplasm TAS,IBA 21873635
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane IEA --
GO:0005768 endosome TAS 9584208
genes like me logo Genes that share ontologies with PI4KB: view

Pathways & Interactions for PI4KB Gene

genes like me logo Genes that share pathways with PI4KB: view

SIGNOR curated interactions for PI4KB Gene

Is activated by:

Gene Ontology (GO) - Biological Process for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006661 phosphatidylinositol biosynthetic process TAS --
GO:0006898 receptor-mediated endocytosis TAS 9584208
GO:0007165 signal transduction TAS 9020160
GO:0016032 viral process IEA --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with PI4KB: view

Drugs & Compounds for PI4KB Gene

(4) Drugs for PI4KB Gene - From: DrugBank, ApexBio, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
fostamatinib Approved, Investigational Pharma Target, inhibitor Kinase Inhibitors 0
Wortmannin Experimental Pharma PI3K inhibitor,selective and irreversible, Potent, irreversible inhibitor of PI 3-kinase. Also inhibitor of PLK1 0
ATP Investigational Nutra Agonist, Activator, Partial agonist, Antagonist, Full agonist, Gating inhibitor, Pore Blocker, Potentiation 0
PIK-93 Pharma PI3Kγ/PI4KIIIβ/PI3Kα inhibitor 0

(3) Additional Compounds for PI4KB Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • 5'-Adenylphosphoric acid
  • Adenosine 5'-diphosphate
  • ADENOSINE-5'-diphosphATE
  • H3ADP
  • 5'-Adenylphosphate
Agonist, Full agonist, Partial agonist, Gating inhibitor, Antagonist 58-64-0

(1) ApexBio Compounds for PI4KB Gene

Compound Action Cas Number
PIK-93 PI3Kγ/PI4KIIIβ/PI3Kα inhibitor 593960-11-3
genes like me logo Genes that share compounds with PI4KB: view

Drug Products

Transcripts for PI4KB Gene

mRNA/cDNA for PI4KB Gene

11 REFSEQ mRNAs :
11 NCBI additional mRNA sequence :
13 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PI4KB

Clone Products

  • Addgene plasmids for PI4KB

Alternative Splicing Database (ASD) splice patterns (SP) for PI4KB Gene

ExUns: 1a · 1b · 1c · 1d ^ 2a · 2b · 2c · 2d ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7 ^ 8a · 8b · 8c ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12a · 12b ^ 13a ·
SP1: - - - - - - -
SP2: - - -
SP3: - - -
SP4: - - - - - - - -
SP5:
SP6:
SP7: - - - - - - - - - -
SP8: - - - - - - -
SP9: -
SP10: - - - - - -
SP11: - - - -
SP12:
SP13:
SP14:

ExUns: 13b · 13c ^ 14a · 14b · 14c ^ 15 ^ 16a · 16b · 16c · 16d
SP1: - -
SP2: - -
SP3: - -
SP4: - -
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: - - -
SP13:
SP14:

Relevant External Links for PI4KB Gene

GeneLoc Exon Structure for
PI4KB

Expression for PI4KB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PI4KB Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

  • Thyroid (Endocrine System)
  • Limb (Muscoskeletal System)

Protein differential expression in normal tissues from HIPED for PI4KB Gene

This gene is overexpressed in Frontal cortex (13.7), CD8 Tcells (9.2), Lymph node (7.4), and Retina (7.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PI4KB Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PI4KB

SOURCE GeneReport for Unigene cluster for PI4KB Gene:

Hs.632465

mRNA Expression by UniProt/SwissProt for PI4KB Gene:

Q9UBF8-PI4KB_HUMAN
Tissue specificity: Widely expressed with highest levels in heart, skeletal muscle, pancreas, testis and ovary. Weakly expressed in liver.

Evidence on tissue expression from TISSUES for PI4KB Gene

  • Nervous system(4.8)
  • Liver(4.4)
  • Skin(2.6)
  • Kidney(2.6)
  • Lung(2.5)
  • Adrenal gland(2.1)
genes like me logo Genes that share expression patterns with PI4KB: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PI4KB Gene

Orthologs for PI4KB Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PI4KB Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PI4KB 30 31
  • 99.64 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia PI4KB 31
  • 94 (a)
OneToOne
Cow
(Bos Taurus)
Mammalia PI4KB 30 31
  • 93.47 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia PI4KB 30 31
  • 93.16 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Pi4kb 30 17 31
  • 92.59 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pi4kb 30
  • 92.57 (n)
Chicken
(Gallus gallus)
Aves PI4KB 31
  • 88 (a)
OneToOne
LOC100859723 30
  • 80.27 (n)
Lizard
(Anolis carolinensis)
Reptilia PI4KB 31
  • 82 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia pi4kb 30
  • 77.96 (n)
Zebrafish
(Danio rerio)
Actinopterygii pi4kb 30 31
  • 75.92 (n)
OneToOne
Rainbow Trout
(Oncorhynchus mykiss)
Actinopterygii Omy.9571 30
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP007512 30
  • 59.17 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta fwd 30 31
  • 53.45 (n)
OneToOne
Worm
(Caenorhabditis elegans)
Secernentea pifk-1 30 31
  • 48.04 (n)
OneToOne
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PIK1 31 33 33
  • 23 (a)
OneToOne
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.2331 31
  • 56 (a)
OneToOne
Sea Vase
(Ciona intestinalis)
Ascidiacea Cin.5032 30
Species where no ortholog for PI4KB was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Platypus (Ornithorhynchus anatinus)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for PI4KB Gene

ENSEMBL:
Gene Tree for PI4KB (if available)
TreeFam:
Gene Tree for PI4KB (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PI4KB: view image

Paralogs for PI4KB Gene

(6) SIMAP similar genes for PI4KB Gene using alignment to 7 proteins:

  • PI4KB_HUMAN
  • A6PVV8_HUMAN
  • E9PIH4_HUMAN
  • E9PL47_HUMAN
  • F8W860_HUMAN
  • H0Y4F8_HUMAN
  • H0YCW3_HUMAN
genes like me logo Genes that share paralogs with PI4KB: view

Variants for PI4KB Gene

Additional dbSNP identifiers (rs#s) for PI4KB Gene

Structural Variations from Database of Genomic Variants (DGV) for PI4KB Gene

Variant ID Type Subtype PubMed ID
dgv2n68 CNV loss 17160897
esv25158 CNV gain 19812545
esv2717851 CNV deletion 23290073
esv34461 CNV gain 17911159
nsv2821 CNV insertion 18451855
nsv522840 CNV gain 19592680
nsv831581 CNV loss 17160897

Variation tolerance for PI4KB Gene

Residual Variation Intolerance Score: 4.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.71; 32.54% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PI4KB Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PI4KB

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PI4KB Gene

Disorders for PI4KB Gene

MalaCards: The human disease database

(4) MalaCards diseases for PI4KB Gene - From: DISEASES and GeneCards

Disorder Aliases PubMed IDs
nonparalytic poliomyelitis
  • acute nonparalytic poliomyelitis
polycystic kidney disease 3 with or without polycystic liver disease
  • pkd3
lowe oculocerebrorenal syndrome
  • ocrl
mouth disease
  • mouth disorders
- elite association - COSMIC cancer census association via MalaCards
Search PI4KB in MalaCards View complete list of genes associated with diseases

Additional Disease Information for PI4KB

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with PI4KB: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PI4KB Gene

Publications for PI4KB Gene

  1. Cloning and characterization of a wortmannin-sensitive human phosphatidylinositol 4-kinase. (PMID: 9020160) Meyers R … Cantley LC (The Journal of biological chemistry 1997) 2 3 4 23
  2. Human phosphatidylinositol 4-kinase isoform PI4K92. Expression of the recombinant enzyme and determination of multiple phosphorylation sites. (PMID: 11277933) Suer S … Heilmeyer LM (European journal of biochemistry 2001) 3 4 23
  3. Identification and characterization of a novel human phosphatidylinositol 4-kinase. (PMID: 9405935) Suzuki K … Horie M (DNA research : an international journal for rapid publication of reports on genes and genomes 1997) 3 4 23
  4. Complementary DNA cloning and chromosomal mapping of a novel phosphatidylinositol kinase gene. (PMID: 9405938) Saito T … Hori T (DNA research : an international journal for rapid publication of reports on genes and genomes 1997) 2 3 4
  5. The Molecular Basis of Aichi Virus 3A Protein Activation of Phosphatidylinositol 4 Kinase IIIβ, PI4KB, through ACBD3. (PMID: 27989622) McPhail JA … Burke JE (Structure (London, England : 1993) 2017) 3 4

Products for PI4KB Gene

Sources for PI4KB Gene