Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of candidate proteins containing a C-terminal CAAX motif in which 'A' is an aliphatic amino acid and 'X' is leucine (summarized by Zhang et al., 1994 [PubMed 8106351]). The enzyme is composed of a 48-kD alpha subunit (FNTA; MIM 134635) and a 43-kD beta subunit, encoded b... See more...

Aliases for PGGT1B Gene

Aliases for PGGT1B Gene

  • Protein Geranylgeranyltransferase Type I Subunit Beta 2 3 5
  • Protein Geranylgeranyltransferase Type I, Beta Subunit 2 3
  • Type I Protein Geranyl-Geranyltransferase Subunit Beta 3 4
  • Geranylgeranyl Transferase Type-1 Subunit Beta 3 4
  • Geranylgeranyl Transferase Type I Subunit Beta 3 4
  • GGTase-I-Beta 3 4
  • EC 2.5.1.59 4 50
  • BGGI 2 3
  • GGTI 2 3
  • Geranylgeranyltransferase Type I Beta Subunit 3
  • CTC-428G20.3 3
  • EC 2.5.1 50
  • PGGT1B 5

External Ids for PGGT1B Gene

Previous GeneCards Identifiers for PGGT1B Gene

  • GC05M114151
  • GC05M114950
  • GC05M114578
  • GC05M114623
  • GC05M114575
  • GC05M109728
  • GC05M114546
  • GC05M115210

Summaries for PGGT1B Gene

Entrez Gene Summary for PGGT1B Gene

  • Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of candidate proteins containing a C-terminal CAAX motif in which 'A' is an aliphatic amino acid and 'X' is leucine (summarized by Zhang et al., 1994 [PubMed 8106351]). The enzyme is composed of a 48-kD alpha subunit (FNTA; MIM 134635) and a 43-kD beta subunit, encoded by the PGGT1B gene. The FNTA gene encodes the alpha subunit for both GGTase-I and the related enzyme farnesyltransferase.[supplied by OMIM, Mar 2010]

GeneCards Summary for PGGT1B Gene

PGGT1B (Protein Geranylgeranyltransferase Type I Subunit Beta) is a Protein Coding gene. Among its related pathways are Cytoskeleton remodeling_RalA regulation pathway and G-protein signaling_RhoB regulation pathway. Gene Ontology (GO) annotations related to this gene include drug binding and protein geranylgeranyltransferase activity. An important paralog of this gene is FNTB.

UniProtKB/Swiss-Prot Summary for PGGT1B Gene

  • Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Known substrates include RAC1, RAC2, RAP1A and RAP1B.

Tocris Summary for PGGT1B Gene

No data available for CIViC Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PGGT1B Gene

Genomics for PGGT1B Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PGGT1B Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PGGT1B on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PGGT1B

Top Transcription factor binding sites by QIAGEN in the PGGT1B gene promoter:
  • AML1a
  • E4BP4
  • FOXJ2
  • FOXJ2 (long isoform)
  • FOXO4
  • HTF
  • Nkx2-2
  • Pax-6
  • STAT3
  • TBP

Genomic Locations for PGGT1B Gene

Latest Assembly
chr5:115,200,247-115,262,887
(GRCh38/hg38)
Size:
62,641 bases
Orientation:
Minus strand

Previous Assembly
chr5:114,539,709-114,598,574
(GRCh37/hg19 by Entrez Gene)
Size:
58,866 bases
Orientation:
Minus strand

chr5:114,546,527-114,598,569
(GRCh37/hg19 by Ensembl)
Size:
52,043 bases
Orientation:
Minus strand

Genomic View for PGGT1B Gene

Genes around PGGT1B on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PGGT1B Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PGGT1B Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PGGT1B Gene

Proteins for PGGT1B Gene

  • Protein details for PGGT1B Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P53609-PGTB1_HUMAN
    Recommended name:
    Geranylgeranyl transferase type-1 subunit beta
    Protein Accession:
    P53609
    Secondary Accessions:
    • Q5MJP9

    Protein attributes for PGGT1B Gene

    Size:
    377 amino acids
    Molecular mass:
    42368 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Heterodimer of FNTA and PGGT1B. PGGT1B mediates interaction with substrate peptides.

    Alternative splice isoforms for PGGT1B Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PGGT1B Gene

Selected DME Specific Peptides for PGGT1B Gene

P53609:
  • QLEDGSF
  • FGICGLSLM
  • YIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEE

Post-translational modifications for PGGT1B Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for PGGT1B Gene

Domains & Families for PGGT1B Gene

Gene Families for PGGT1B Gene

Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for PGGT1B Gene

InterPro:
Blocks:
  • Prenyltransferase/squalene oxidase

Suggested Antigen Peptide Sequences for PGGT1B Gene

GenScript: Design optimal peptide antigens:
  • Type I protein geranyl-geranyltransferase subunit beta (PGTB1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P53609

UniProtKB/Swiss-Prot:

PGTB1_HUMAN :
  • Belongs to the protein prenyltransferase subunit beta family.
Family:
  • Belongs to the protein prenyltransferase subunit beta family.
genes like me logo Genes that share domains with PGGT1B: view

Function for PGGT1B Gene

Molecular function for PGGT1B Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Known substrates include RAC1, RAC2, RAP1A and RAP1B.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=geranylgeranyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-geranylgeranyl-L-cysteinyl-[protein]; Xref=Rhea:RHEA:21240, Rhea:RHEA-COMP:10131, Rhea:RHEA-COMP:11537, ChEBI:CHEBI:29950, ChEBI:CHEBI:33019, ChEBI:CHEBI:57533, ChEBI:CHEBI:86021; EC=2.5.1.59; Evidence={ECO:0000269|PubMed:8106351};.

Enzyme Numbers (IUBMB) for PGGT1B Gene

Phenotypes From GWAS Catalog for PGGT1B Gene

Gene Ontology (GO) - Molecular Function for PGGT1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0004659 prenyltransferase activity IEA --
GO:0004661 protein geranylgeranyltransferase activity IEA,IDA 16893176
GO:0004662 CAAX-protein geranylgeranyltransferase activity TAS,ISS --
GO:0005515 protein binding IPI 24981860
genes like me logo Genes that share ontologies with PGGT1B: view
genes like me logo Genes that share phenotypes with PGGT1B: view

Animal Models for PGGT1B Gene

MGI Knock Outs for PGGT1B:

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PGGT1B

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PGGT1B Gene

Localization for PGGT1B Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PGGT1B gene
Compartment Confidence
nucleus 3
cytosol 3
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1
peroxisome 1
endoplasmic reticulum 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Endoplasmic reticulum (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PGGT1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005953 CAAX-protein geranylgeranyltransferase complex TAS,IDA 16893176
genes like me logo Genes that share ontologies with PGGT1B: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for PGGT1B Gene

Pathways & Interactions for PGGT1B Gene

PathCards logo

SuperPathways for PGGT1B Gene

SuperPathway Contained pathways
1 Cytoskeleton remodeling_RalA regulation pathway
-
2 G-protein signaling_Rac2 regulation pathway
-
3 G-protein signaling_Rap1A regulation pathway
-
4 G-protein signaling_Rap1B regulation pathway
-
5 G-protein signaling_Rap2B regulation pathway
-
genes like me logo Genes that share pathways with PGGT1B: view

Pathways by source for PGGT1B Gene

8 GeneGo (Thomson Reuters) pathways for PGGT1B Gene
  • Cytoskeleton remodeling_RalA regulation pathway
  • G-protein signaling_Rac2 regulation pathway
  • G-protein signaling_Rap1A regulation pathway
  • G-protein signaling_Rap1B regulation pathway
  • G-protein signaling_Rap2B regulation pathway

Gene Ontology (GO) - Biological Process for PGGT1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008284 positive regulation of cell proliferation IEA --
GO:0018215 protein phosphopantetheinylation IEA --
GO:0018342 protein prenylation IBA 21873635
GO:0018344 protein geranylgeranylation TAS,IDA 16893176
GO:0034097 response to cytokine IEA --
genes like me logo Genes that share ontologies with PGGT1B: view

No data available for SIGNOR curated interactions for PGGT1B Gene

Drugs & Compounds for PGGT1B Gene

(6) Drugs for PGGT1B Gene - From: DrugBank, DGIdb, HMDB, and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Pravastatin Approved Pharma 170
2-[METHYL-(5-GERANYL-4-METHYL-PENT-3-ENYL)-AMINO]-ETHYL-DIPHOSPHATE Experimental Pharma Target 0
geranylgeranyl diphosphate Experimental Pharma Target 0
L-778123 Experimental Pharma Target 0
GGTI-2418 Pharma 0

(4) Additional Compounds for PGGT1B Gene - From: HMDB and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Geranylgeranyl-PP
  • all-trans-Geranylgeranyl diphosphate
  • all-trans-Geranylgeranyl pyrophosphate
  • Geranylgeranyl diphosphate
  • Geranylgeranyl pyrophosphate
  • GGDP
6699-20-3
pyrophosphate
  • [(HO)2P(O)OP(O)(OH)2]
  • Acide diphosphorique
  • Diphosphorsaeure
  • H4P2O7
  • Pyrophosphoric acid
14000-31-8
FTI 277
1217447-06-7
GGTI 298
1217457-86-7

(3) Tocris Compounds for PGGT1B Gene

Compound Action Cas Number
FTI 277 Prodrug form of FTI 276 (Cat. No. 2406) 1217447-06-7
GGTI 298 Geranylgeranyltransferase I (GGTase I) inhibitor 1217457-86-7
LB 42708 Selective farnesyltransferase (FTase) inhibitor 226929-39-1
genes like me logo Genes that share compounds with PGGT1B: view

Transcripts for PGGT1B Gene

mRNA/cDNA for PGGT1B Gene

1 REFSEQ mRNAs :
5 NCBI additional mRNA sequence :
5 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PGGT1B

Alternative Splicing Database (ASD) splice patterns (SP) for PGGT1B Gene

No ASD Table

Relevant External Links for PGGT1B Gene

GeneLoc Exon Structure for
PGGT1B

Expression for PGGT1B Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PGGT1B Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PGGT1B Gene

This gene is overexpressed in Peripheral blood mononuclear cells (7.6) and Spleen (7.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PGGT1B Gene



Protein tissue co-expression partners for PGGT1B Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PGGT1B

SOURCE GeneReport for Unigene cluster for PGGT1B Gene:

Hs.254006

Evidence on tissue expression from TISSUES for PGGT1B Gene

  • Kidney(4.3)
genes like me logo Genes that share expression patterns with PGGT1B: view

Primer products for research

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PGGT1B Gene

Orthologs for PGGT1B Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PGGT1B Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PGGT1B 29 30
  • 99.65 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia PGGT1B 30
  • 95 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia PGGT1B 30
  • 95 (a)
OneToOne
Dog
(Canis familiaris)
Mammalia PGGT1B 29 30
  • 94.08 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia PGGT1B 29 30
  • 92.48 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pggt1b 29
  • 89.92 (n)
Mouse
(Mus musculus)
Mammalia Pggt1b 29 16 30
  • 87.18 (n)
OneToOne
Chicken
(Gallus gallus)
Aves PGGT1B 29 30
  • 82.01 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia PGGT1B 30
  • 86 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia pggt1b 29
  • 74.84 (n)
Str.1329 29
African clawed frog
(Xenopus laevis)
Amphibia Xl.4454 29
Zebrafish
(Danio rerio)
Actinopterygii pggt1b 29 30
  • 65.71 (n)
OneToOne
Dr.10651 29
Fruit Fly
(Drosophila melanogaster)
Insecta betaggt-I 29 30
  • 51.55 (n)
OneToOne
&bgr;ggt-I 31
  • 44 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008406 29
  • 51.46 (n)
Worm
(Caenorhabditis elegans)
Secernentea Y48E1B.3 29 30
  • 51.13 (n)
OneToOne
csp-1 31
  • 40 (a)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes BET2 30
  • 27 (a)
OneToMany
Thale Cress
(Arabidopsis thaliana)
eudicotyledons PGGT-I 29
  • 51.04 (n)
Rice
(Oryza sativa)
Liliopsida Os01g0150100 29
  • 52.67 (n)
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.3753 30
  • 51 (a)
OneToOne
Species where no ortholog for PGGT1B was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for PGGT1B Gene

ENSEMBL:
Gene Tree for PGGT1B (if available)
TreeFam:
Gene Tree for PGGT1B (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PGGT1B: view image
Alliance of Genome Resources:
Additional Orthologs for PGGT1B

Paralogs for PGGT1B Gene

Paralogs for PGGT1B Gene

Pseudogenes.org Pseudogenes for PGGT1B Gene

genes like me logo Genes that share paralogs with PGGT1B: view

Variants for PGGT1B Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PGGT1B Gene

SNP ID Clinical significance and condition Chr 05 pos Variation AA Info Type
rs34918686 -- p.Ile103Val

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for PGGT1B Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for PGGT1B Gene

Variant ID Type Subtype PubMed ID
esv3566493 CNV deletion 23714750
nsv1029371 CNV loss 25217958
nsv478622 CNV novel sequence insertion 20440878
nsv830453 CNV gain 17160897
nsv830454 CNV gain+loss 17160897
nsv980715 CNV duplication 23825009

Variation tolerance for PGGT1B Gene

Residual Variation Intolerance Score: 23.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.53; 44.12% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PGGT1B Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PGGT1B
Leiden Open Variation Database (LOVD)
PGGT1B

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PGGT1B Gene

Disorders for PGGT1B Gene

Additional Disease Information for PGGT1B

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform

No disorders were found for PGGT1B Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PGGT1B Gene

Publications for PGGT1B Gene

  1. cDNA cloning and expression of rat and human protein geranylgeranyltransferase type-I. (PMID: 8106351) Zhang FL … Omer CA (The Journal of biological chemistry 1994) 2 3 4
  2. Genome-wide scan of 500,000 single-nucleotide polymorphisms among responders and nonresponders to interferon beta therapy in multiple sclerosis. (PMID: 19667218) Comabella M … Montalban X (Archives of neurology 2009) 3 40
  3. Systematic mapping of genetic interactions for de novo fatty acid synthesis identifies C12orf49 as a regulator of lipid metabolism. (PMID: 32694731) Aregger M … Moffat J (Nature metabolism 2020) 3
  4. Extensive rewiring of the EGFR network in colorectal cancer cells expressing transforming levels of KRASG13D. (PMID: 31980649) Kennedy SA … Kolch W (Nature communications 2020) 3
  5. A reference map of the human binary protein interactome. (PMID: 32296183) Luck K … Calderwood MA (Nature 2020) 3

Products for PGGT1B Gene

Sources for PGGT1B Gene