This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into... See more...

Aliases for PGC Gene

Aliases for PGC Gene

  • Progastricsin 2 3 5
  • Pepsinogen C 2 3 4
  • EC 3.4.23.3 4 51
  • Gastricsin 3 4
  • Progastricsin (Pepsinogen C) 2
  • Pepsinogen Group II 3
  • Preprogastricsin 3
  • EC 3.4.23 51
  • Pepsin C 3
  • PEPC 3
  • PGII 3
  • PGC 5

External Ids for PGC Gene

Previous GeneCards Identifiers for PGC Gene

  • GC06M041706
  • GC06M041751
  • GC06M041813
  • GC06M041704
  • GC06M041423

Summaries for PGC Gene

Entrez Gene Summary for PGC Gene

  • This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into its active mature form at low pH by sequential cleavage of the prosegment that is carried out by the enzyme itself. Polymorphisms in this gene are associated with susceptibility to gastric cancers. Serum levels of this enzyme are used as a biomarker for certain gastric diseases including Helicobacter pylori related gastritis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009]

GeneCards Summary for PGC Gene

PGC (Progastricsin) is a Protein Coding gene. Diseases associated with PGC include Gastritis and Atrophic Gastritis. Gene Ontology (GO) annotations related to this gene include aspartic-type endopeptidase activity. An important paralog of this gene is PGA5.

UniProtKB/Swiss-Prot Summary for PGC Gene

Gene Wiki entry for PGC Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PGC Gene

Genomics for PGC Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PGC Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PGC on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PGC

Top Transcription factor binding sites by QIAGEN in the PGC gene promoter:
  • Brachyury
  • C/EBPbeta
  • CP2
  • FOXD1
  • HOXA9B
  • Meis-1
  • Meis-1b
  • MZF-1
  • p300
  • p53

Genomic Locations for PGC Gene

Genomic Locations for PGC Gene
chr6:41,736,711-41,754,109
(GRCh38/hg38)
Size:
17,399 bases
Orientation:
Minus strand
chr6:41,704,449-41,721,847
(GRCh37/hg19)
Size:
17,399 bases
Orientation:
Minus strand

Genomic View for PGC Gene

Genes around PGC on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PGC Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PGC Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PGC Gene

Proteins for PGC Gene

  • Protein details for PGC Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P20142-PEPC_HUMAN
    Recommended name:
    Gastricsin
    Protein Accession:
    P20142
    Secondary Accessions:
    • B4DVZ3
    • Q5T3D7
    • Q5T3D8

    Protein attributes for PGC Gene

    Size:
    388 amino acids
    Molecular mass:
    42426 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAA60062.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for PGC Gene

    Alternative splice isoforms for PGC Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PGC Gene

Selected DME Specific Peptides for PGC Gene

P20142:
  • GGVDSSLYTG
  • QEGALTSP
  • DTGSSNLW
  • SLYTGQI
  • WILGDVF
  • VVKVPLKK
  • SSTYSTNGQTFSLQYGSGSLTGFFGYDT
  • NNRVGFA
  • RVGFATA
  • YFGEISIGTP
  • YFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACT
  • PVTQELYWQI
  • ISIGTPP
  • AIVDTGTSL
  • KSIRETMKE
  • ILGDVFL
  • LWVPSVYC
  • VPQQYMSA
  • GTPPQNF

Post-translational modifications for PGC Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for PGC Gene

Domains & Families for PGC Gene

Gene Families for PGC Gene

HGNC:
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Enzymes
  • Predicted intracellular proteins
  • Predicted secreted proteins
  • Transporters

Protein Domains for PGC Gene

InterPro:
Blocks:
  • Pepsin (A1) aspartic protease family signature
ProtoNet:

Suggested Antigen Peptide Sequences for PGC Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ58861, highly similar to Gastricsin (EC 3.4.23.3) (B4DVZ3_HUMAN)
  • Pepsinogen C (PEPC_HUMAN)

Graphical View of Domain Structure for InterPro Entry

P20142

UniProtKB/Swiss-Prot:

PEPC_HUMAN :
  • Belongs to the peptidase A1 family.
Family:
  • Belongs to the peptidase A1 family.
genes like me logo Genes that share domains with PGC: view

Function for PGC Gene

Molecular function for PGC Gene

UniProtKB/Swiss-Prot Function:
Hydrolyzes a variety of proteins.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=More restricted specificity than pepsin A, but shows preferential cleavage at Tyr-|-Xaa bonds. High activity on hemoglobin.; EC=3.4.23.3;.
GENATLAS Biochemistry:
progastricsin (pepsinogen C)

Enzyme Numbers (IUBMB) for PGC Gene

Phenotypes From GWAS Catalog for PGC Gene

Gene Ontology (GO) - Molecular Function for PGC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004190 aspartic-type endopeptidase activity TAS,IMP 12759353
GO:0008233 peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with PGC: view
genes like me logo Genes that share phenotypes with PGC: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PGC

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PGC

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for PGC Gene

Localization for PGC Gene

Subcellular locations from UniProtKB/Swiss-Prot for PGC Gene

Secreted.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PGC gene
Compartment Confidence
extracellular 5
plasma membrane 3
nucleus 3
cytoskeleton 2
mitochondrion 2
cytosol 2
lysosome 2
golgi apparatus 2
peroxisome 1
endoplasmic reticulum 1
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PGC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA --
GO:0005615 extracellular space TAS,IDA 12759353
genes like me logo Genes that share ontologies with PGC: view

Pathways & Interactions for PGC Gene

PathCards logo

SuperPathways for PGC Gene

No Data Available

Gene Ontology (GO) - Biological Process for PGC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002803 positive regulation of antibacterial peptide production IMP 12759353
GO:0006508 proteolysis TAS --
GO:0007586 digestion IEA --
GO:0030163 protein catabolic process IBA --
genes like me logo Genes that share ontologies with PGC: view

No data available for Pathways by source and SIGNOR curated interactions for PGC Gene

Drugs & Compounds for PGC Gene

(1) Drugs for PGC Gene - From: DGIdb

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Ecabet Investigational Pharma 5

(1) Additional Compounds for PGC Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with PGC: view

Transcripts for PGC Gene

mRNA/cDNA for PGC Gene

2 REFSEQ mRNAs :
7 NCBI additional mRNA sequence :
4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PGC

Alternative Splicing Database (ASD) splice patterns (SP) for PGC Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9
SP1:
SP2: - -

Relevant External Links for PGC Gene

GeneLoc Exon Structure for
PGC

Expression for PGC Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PGC Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for PGC Gene

This gene is overexpressed in Stomach (x51.9).

Protein differential expression in normal tissues from HIPED for PGC Gene

This gene is overexpressed in Stomach (49.9) and Cardia (15.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PGC Gene



Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PGC

SOURCE GeneReport for Unigene cluster for PGC Gene:

Hs.1867

Evidence on tissue expression from TISSUES for PGC Gene

  • Stomach(5)
  • Liver(4.3)
  • Lung(3)
  • Intestine(2.6)
  • Skin(2.5)
  • Nervous system(2.5)
  • Blood(2.3)
  • Kidney(2.3)
  • Pancreas(2.2)
genes like me logo Genes that share expression patterns with PGC: view

No data available for Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PGC Gene

Orthologs for PGC Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PGC Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PGC 30 31
  • 99.57 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia PGC 30 31
  • 86.56 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia PGC 31
  • 80 (a)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pgc 30
  • 79.98 (n)
Mouse
(Mus musculus)
Mammalia Pgc 30 17 31
  • 78.87 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia PGC 31
  • 61 (a)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia PGC 31
  • 44 (a)
OneToOne
Chicken
(Gallus gallus)
Aves PGC 30 31
  • 71.25 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia PGC 31
  • 73 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia LOC496913 30
  • 66.85 (n)
African clawed frog
(Xenopus laevis)
Amphibia pgc-A 30
Fruit Fly
(Drosophila melanogaster)
Insecta CG13095 32
  • 43 (a)
CG17134 32
  • 43 (a)
CG6508 32
  • 42 (a)
pcl 32
  • 41 (a)
CG10104 32
  • 39 (a)
CG5860 32
  • 37 (a)
CG17283 32
  • 35 (a)
Worm
(Caenorhabditis elegans)
Secernentea asp-2 32
  • 34 (a)
C11D2.2 32
  • 34 (a)
Y39B6A.23 32
  • 34 (a)
asp-6 32
  • 33 (a)
F21F8.4 32
  • 33 (a)
asp-5 32
  • 32 (a)
Y39B6A.21 32
  • 32 (a)
Y39B6A.24 32
  • 32 (a)
F28A12.4 32
  • 31 (a)
F59D6.2 32
  • 31 (a)
C15C8.3 32
  • 31 (a)
Y39B6A.22 32
  • 31 (a)
F59D6.3 32
  • 30 (a)
A. gosspyii yeast
(Eremothecium gossypii)
Saccharomycetes AGOS_ACR144W 30
  • 50.75 (n)
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YPS3 33
Species where no ortholog for PGC was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)
  • Zebrafish (Danio rerio)

Evolution for PGC Gene

ENSEMBL:
Gene Tree for PGC (if available)
TreeFam:
Gene Tree for PGC (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PGC: view image

Paralogs for PGC Gene

Paralogs for PGC Gene

(7) SIMAP similar genes for PGC Gene using alignment to 3 proteins:

  • PEPC_HUMAN
  • A2A3L9_HUMAN
  • Q4VXA6_HUMAN

Pseudogenes.org Pseudogenes for PGC Gene

genes like me logo Genes that share paralogs with PGC: view

Variants for PGC Gene

Additional dbSNP identifiers (rs#s) for PGC Gene

Structural Variations from Database of Genomic Variants (DGV) for PGC Gene

Variant ID Type Subtype PubMed ID
dgv10637n54 CNV gain 21841781
esv2211967 CNV deletion 18987734
esv2731977 CNV deletion 23290073
esv2731978 CNV deletion 23290073
nsv602988 CNV loss 21841781

Variation tolerance for PGC Gene

Residual Variation Intolerance Score: 46.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.05; 21.42% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PGC Gene

Human Gene Mutation Database (HGMD)
PGC
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PGC

SNP Genotyping and Copy Number Assay Products

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PGC Gene

Disorders for PGC Gene

MalaCards: The human disease database

(6) MalaCards diseases for PGC Gene - From: DISEASES, Novoseek, and GeneCards

- elite association - COSMIC cancer census association via MalaCards
Search PGC in MalaCards View complete list of genes associated with diseases

Additional Disease Information for PGC

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
genes like me logo Genes that share disorders with PGC: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PGC Gene

Publications for PGC Gene

  1. Structural characterization of activation 'intermediate 2' on the pathway to human gastricsin. (PMID: 9406551) Khan AR … James MN (Nature structural biology 1997) 3 4 23
  2. Crystal and molecular structures of human progastricsin at 1.62 A resolution. (PMID: 7714902) Moore SA … James MN (Journal of molecular biology 1995) 3 4 23
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 41
  4. [Correlation of pepsinogen C (PGC) gene insertion/deletion polymorphism to PGC protein expression in gastric mucosa and serum]. (PMID: 19624876) Sun LP … Yuan Y (Ai zheng = Aizheng = Chinese journal of cancer 2009) 3 41
  5. Impact of pepsinogen C polymorphism on individual susceptibility to gastric cancer and its precancerous conditions in a Northeast Chinese population. (PMID: 19132389) Sun LP … Yuan Y (Journal of cancer research and clinical oncology 2009) 3 41

Products for PGC Gene

Sources for PGC Gene