Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of E1 to inactivate the E1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the E1 component to reverse the effec... See more...

Aliases for PDP1 Gene

Aliases for PDP1 Gene

  • Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 1 2 3 4
  • PDP 2 3 4
  • [Pyruvate Dehydrogenase [Acetyl-Transferring]]-Phosphatase 1, Mitochondrial 3 4
  • Protein Phosphatase 2C, Magnesium-Dependent, Catalytic Subunit 2 3
  • Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 1 3 5
  • Protein Phosphatase, Mg2+/Mn2+ Dependent 2A 2 3
  • EC 3.1.3.43 4 50
  • PDPC 1 3 4
  • PPM2A 2 3
  • PPM2C 3 4
  • PDP 1 3 4
  • PDH 2 3
  • Pyruvate Dehydrogenase (Lipoamide) Phosphatase-Phosphatase 3
  • Protein Phosphatase 2C 4
  • EC 3.1.3 50
  • PDPC 3
  • PDP1 5

External Ids for PDP1 Gene

Previous HGNC Symbols for PDP1 Gene

  • PPM2C

Previous GeneCards Identifiers for PDP1 Gene

  • GC08P094999
  • GC08P090137
  • GC08P094870

Summaries for PDP1 Gene

Entrez Gene Summary for PDP1 Gene

  • Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of E1 to inactivate the E1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the E1 component to reverse the effects of pyruvate dehydrogenase kinases. Pyruvate dehydrogenase phosphatase is a heterodimer consisting of catalytic and regulatory subunits. Two catalytic subunits have been reported; one is predominantly expressed in skeletal muscle and another one is is much more abundant in the liver. The catalytic subunit, encoded by this gene, is the former, and belongs to the protein phosphatase 2C (PP2C) superfamily. Along with the pyruvate dehydrogenase complex and pyruvate dehydrogenase kinases, this enzyme is located in the mitochondrial matrix. Mutation in this gene causes pyruvate dehydrogenase phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Jun 2009]

GeneCards Summary for PDP1 Gene

PDP1 (Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 1) is a Protein Coding gene. Diseases associated with PDP1 include Pyruvate Dehydrogenase Phosphatase Deficiency and Atypical Autism. Among its related pathways are Metabolism and Regulation of CFTR activity (norm and CF). Gene Ontology (GO) annotations related to this gene include protein serine/threonine phosphatase activity and [pyruvate dehydrogenase (lipoamide)] phosphatase activity. An important paralog of this gene is PDP2.

UniProtKB/Swiss-Prot Summary for PDP1 Gene

  • Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Gene Wiki entry for PDP1 Gene

No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PDP1 Gene

Genomics for PDP1 Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PDP1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH08J093915 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE CraniofacialAtlas dbSUPER 265.4 +60.2 60222 5.1 MYC IKZF1 ZNF600 ZMYM3 BRCA1 POLR2A NFIC ZIC2 ZBTB10 YY1 PDP1 HSALNG0067003 MIR378D2 MIR378D2HG CIBAR1 LINC00535 ENSG00000253854 PSMA2P2 lnc-CDH17-4 lnc-PDP1-1
GH08J093855 Promoter/Enhancer 1.2 EPDnew Ensembl ENCODE dbSUPER 250.7 -0.6 -590 2.5 JUND TEAD3 ZNF644 HLF FOS EP300 ZNF121 CBFA2T3 PDP1 lnc-PDP1-1 MIR378D2HG HSALNG0066998 TMEM67
GH08J093858 Enhancer 0.3 Ensembl dbSUPER 250.7 +1.1 1094 0.6 PDP1 lnc-PDP1-1 MIR378D2HG lnc-RBM12B-6 CDH17
GH08J093931 Enhancer 1.4 FANTOM5 Ensembl ENCODE dbSUPER 16.5 +76.8 76794 6.8 JUND CEBPA NFIC CEBPB TRIM22 MAX FOXA2 CUX1 ETV4 CBFB PDP1 ENSG00000253722 GEM PSMA2P2 lnc-CDH17-4 HSALNG0067003 CDH17
GH08J093900 Enhancer 1 Ensembl ENCODE dbSUPER 17 +46.3 46252 7.1 JUND YY1 EP300 SPI1 PKNOX1 MAFK IKZF1 MAFF ARID3A POLR2A LOC105375646 PDP1 LINC00535 CIBAR1 FSBP MN298678-085 MIR378D2HG lnc-PDP1-1 CDH17
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PDP1 on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PDP1

Genomic Locations for PDP1 Gene

Latest Assembly
chr8:93,857,807-93,926,068
(GRCh38/hg38)
Size:
68,262 bases
Orientation:
Plus strand

Previous Assembly
chr8:94,929,151-94,938,296
(GRCh37/hg19 by Entrez Gene)
Size:
9,146 bases
Orientation:
Plus strand

chr8:94,870,035-94,938,294
(GRCh37/hg19 by Ensembl)
Size:
68,260 bases
Orientation:
Plus strand

Genomic View for PDP1 Gene

Genes around PDP1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PDP1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PDP1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PDP1 Gene

Proteins for PDP1 Gene

  • Protein details for PDP1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9P0J1-PDP1_HUMAN
    Recommended name:
    [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
    Protein Accession:
    Q9P0J1
    Secondary Accessions:
    • B3KX71
    • J3KPU0
    • Q5U5K1

    Protein attributes for PDP1 Gene

    Size:
    537 amino acids
    Molecular mass:
    61054 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Heterodimer of a catalytic (PDP1) and a regulatory (PDPR) subunit.
    SequenceCaution:
    • Sequence=AAF67480.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for PDP1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PDP1 Gene

Selected DME Specific Peptides for PDP1 Gene

Q9P0J1:
  • DQNAATHLIRHA
  • LPANAPIEDRRSA
  • ARMYRDDIT
  • WWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEF
  • PEVTYHRLRPQDKFLVLA
  • FLVLATDG
  • RYTPHPAYATF
  • QAVSERLFYY
  • VAFSGATAC
  • NAATHLIRH
  • LRTYWQELIDLNTGES

Post-translational modifications for PDP1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for PDP1 Gene

Gene Families for PDP1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Protein Domains for PDP1 Gene

Suggested Antigen Peptide Sequences for PDP1 Gene

GenScript: Design optimal peptide antigens:
  • Pyruvate dehydrogenase phosphatase catalytic subunit 1 (PDP1_HUMAN)
  • PPM2C protein (Q6P1N1_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q9P0J1

UniProtKB/Swiss-Prot:

PDP1_HUMAN :
  • Belongs to the PP2C family.
Family:
  • Belongs to the PP2C family.
genes like me logo Genes that share domains with PDP1: view

Function for PDP1 Gene

Molecular function for PDP1 Gene

UniProtKB/Swiss-Prot Function:
Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=H2O + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = L-seryl-[pyruvate dehydrogenase E1 alpha subunit] + phosphate; Xref=Rhea:RHEA:12669, Rhea:RHEA-COMP:13689, Rhea:RHEA-COMP:13690, ChEBI:CHEBI:15377, ChEBI:CHEBI:29999, ChEBI:CHEBI:43474, ChEBI:CHEBI:83421; EC=3.1.3.43;.

Enzyme Numbers (IUBMB) for PDP1 Gene

Phenotypes From GWAS Catalog for PDP1 Gene

Gene Ontology (GO) - Molecular Function for PDP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0004721 phosphoprotein phosphatase activity IEA --
GO:0004722 protein serine/threonine phosphatase activity IDA 20801214
GO:0004724 magnesium-dependent protein serine/threonine phosphatase activity IBA 21873635
GO:0004741 [pyruvate dehydrogenase (lipoamide)] phosphatase activity IBA 21873635
genes like me logo Genes that share ontologies with PDP1: view
genes like me logo Genes that share phenotypes with PDP1: view

Human Phenotype Ontology for PDP1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PDP1

Clone products for research

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for PDP1 Gene

Localization for PDP1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PDP1 Gene

Mitochondrion matrix.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PDP1 gene
Compartment Confidence
mitochondrion 5
nucleus 3
cytosol 3
plasma membrane 2
extracellular 2
cytoskeleton 1
peroxisome 1
endoplasmic reticulum 1
endosome 1
lysosome 1
golgi apparatus 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Mitochondria (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PDP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IBA 21873635
GO:0005759 mitochondrial matrix TAS --
genes like me logo Genes that share ontologies with PDP1: view

Pathways & Interactions for PDP1 Gene

genes like me logo Genes that share pathways with PDP1: view

Pathways by source for PDP1 Gene

2 GeneGo (Thomson Reuters) pathways for PDP1 Gene
  • Apoptosis and survival BAD phosphorylation
  • Regulation of CFTR activity (norm and CF)
1 Cell Signaling Technology pathway for PDP1 Gene

SIGNOR curated interactions for PDP1 Gene

Activates:
Inactivates:

Gene Ontology (GO) - Biological Process for PDP1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006470 protein dephosphorylation IBA 21873635
GO:0010510 regulation of acetyl-CoA biosynthetic process from pyruvate TAS --
GO:0035970 peptidyl-threonine dephosphorylation IDA 20801214
GO:1904184 positive regulation of pyruvate dehydrogenase activity IBA 21873635
genes like me logo Genes that share ontologies with PDP1: view

Drugs & Compounds for PDP1 Gene

(35) Drugs for PDP1 Gene - From: DrugBank, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Magnesium Approved, Experimental, Investigational Pharma 0
Water Approved Pharma 0
L-3-Phenyllactic acid Experimental Pharma Target 0
Phenylpyruvic acid Experimental Pharma Target 0
Uracil Experimental, Investigational Pharma Target 0

(24) Additional Compounds for PDP1 Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with PDP1: view

Transcripts for PDP1 Gene

mRNA/cDNA for PDP1 Gene

5 REFSEQ mRNAs :
17 NCBI additional mRNA sequence :
10 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PDP1

Clone products for research

Alternative Splicing Database (ASD) splice patterns (SP) for PDP1 Gene

ExUns: 1 ^ 2a · 2b ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8a · 8b · 8c · 8d · 8e
SP1: -
SP2: - - - - - - -
SP3: - - - - - - - -
SP4: - - - - - -
SP5: - - - - -
SP6: - - -
SP7:

Relevant External Links for PDP1 Gene

GeneLoc Exon Structure for
PDP1

Expression for PDP1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PDP1 Gene

mRNA differential expression in normal tissues according to GTEx for PDP1 Gene

This gene is overexpressed in Brain - Frontal Cortex (BA9) (x5.0).

Protein differential expression in normal tissues from HIPED for PDP1 Gene

This gene is overexpressed in Liver (14.8) and Nasal epithelium (8.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PDP1 Gene



Protein tissue co-expression partners for PDP1 Gene

- Elite partner

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PDP1

SOURCE GeneReport for Unigene cluster for PDP1 Gene:

Hs.22265

Evidence on tissue expression from TISSUES for PDP1 Gene

  • Nervous system(4.9)
  • Adrenal gland(4.3)
  • Heart(2.6)
  • Muscle(2.4)
  • Kidney(2.1)

Phenotype-based relationships between genes and organs from Gene ORGANizer for PDP1 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • digestive
  • nervous
  • skeletal muscle
  • skeleton
Regions:
Head and neck:
  • brain
  • eye
  • head
  • mouth
  • pharynx
Thorax:
  • esophagus
Abdomen:
  • stomach
Limb:
  • lower limb
General:
  • peripheral nerve
  • peripheral nervous system
genes like me logo Genes that share expression patterns with PDP1: view

Primer products for research

No data available for mRNA Expression by UniProt/SwissProt for PDP1 Gene

Orthologs for PDP1 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PDP1 Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PDP1 29 30
  • 99.64 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pdp1 29
  • 92.65 (n)
Cow
(Bos Taurus)
Mammalia PDP1 29 30
  • 92.43 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Pdp1 29 16 30
  • 92.17 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia PDP1 30
  • 92 (a)
OneToOne
Dog
(Canis familiaris)
Mammalia PDP1 29 30
  • 90.75 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia PDP1 30
  • 88 (a)
OneToOne
Chicken
(Gallus gallus)
Aves PDP1 29 30
  • 80.08 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia PDP1 30
  • 90 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia pdp1 29
  • 75.02 (n)
Zebrafish
(Danio rerio)
Actinopterygii pdp1 29 30
  • 69.33 (n)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008349 29
  • 51.4 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta Pdp 29 30
  • 50.98 (n)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea pdp-1 29 30
  • 47.03 (n)
OneToMany
Baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PTC5 30 32
  • 22 (a)
OneToMany
Species where no ortholog for PDP1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Squirt (Ciona savignyi)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)

Evolution for PDP1 Gene

ENSEMBL:
Gene Tree for PDP1 (if available)
TreeFam:
Gene Tree for PDP1 (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PDP1: view image
Alliance of Genome Resources:
Additional Orthologs for PDP1

Paralogs for PDP1 Gene

(2) SIMAP similar genes for PDP1 Gene using alignment to 6 proteins:

  • PDP1_HUMAN
  • E5RFL8_HUMAN
  • E5RHB9_HUMAN
  • E5RI96_HUMAN
  • E5RIE5_HUMAN
  • E5RIV4_HUMAN
genes like me logo Genes that share paralogs with PDP1: view

Variants for PDP1 Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PDP1 Gene

SNP ID Clinical significance and condition Chr 08 pos Variation AA Info Type
1004779 Uncertain Significance: not provided 93,923,343(+) T/A
NM_018444.4(PDP1):c.1284T>A (p.Asp428Glu)
MISSENSE
1007261 Uncertain Significance: not provided 93,923,340(+) G/C
NM_018444.4(PDP1):c.1281G>C (p.Gln427His)
MISSENSE
1012600 Likely Benign: not provided 93,923,154(+) A/G
NM_018444.4(PDP1):c.1095A>G (p.Gln365=)
SYNONYMOUS
1019550 Uncertain Significance: not provided 93,922,985(+) C/T
NM_018444.4(PDP1):c.926C>T (p.Thr309Met)
MISSENSE
1044534 Uncertain Significance: not provided 93,923,333(+) A/G
NM_018444.4(PDP1):c.1274A>G (p.His425Arg)
MISSENSE

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for PDP1 Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for PDP1 Gene

Variant ID Type Subtype PubMed ID
nsv1022473 CNV loss 25217958

Variation tolerance for PDP1 Gene

Residual Variation Intolerance Score: 8.98% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.78; 16.50% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PDP1 Gene

Human Gene Mutation Database (HGMD)
PDP1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PDP1
Leiden Open Variation Database (LOVD)
PDP1

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PDP1 Gene

Disorders for PDP1 Gene

MalaCards: The human disease database

(15) MalaCards diseases for PDP1 Gene - From: OMI, CVR, GTR, ORP, COP, and GCD

- elite association - COSMIC cancer census association via MalaCards
Search PDP1 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

PDP1_HUMAN
  • Pyruvate dehydrogenase phosphatase deficiency (PDP deficiency) [MIM:608782]: Results in lactic acidosis leading to neurological dysfunction. {ECO:0000269 PubMed:15855260}. Note=The disease is caused by variants affecting the gene represented in this entry.

Additional Disease Information for PDP1

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform
genes like me logo Genes that share disorders with PDP1: view

No data available for Genatlas for PDP1 Gene

Publications for PDP1 Gene

  1. Pyruvate dehydrogenase phosphatase deficiency: identification of the first mutation in two brothers and restoration of activity by protein complementation. (PMID: 15855260) Maj MC … Cameron JM (The Journal of clinical endocrinology and metabolism 2005) 3 4 22 72
  2. Crystallization and preliminary crystallographic studies of the catalytic subunits of human pyruvate dehydrogenase phosphatase isoforms 1 and 2. (PMID: 20208177) Kato J … Kato M (Acta crystallographica. Section F, Structural biology and crystallization communications 2010) 3 22
  3. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 40
  4. Pyruvate dehydrogenase phosphatase 1 (PDP1) null mutation produces a lethal infantile phenotype. (PMID: 19184109) Cameron JM … Robinson BH (Human genetics 2009) 3 22
  5. Decreased PDH activation and glycogenolysis during exercise following fat adaptation with carbohydrate restoration. (PMID: 16188909) Stellingwerff T … Burke LM (American journal of physiology. Endocrinology and metabolism 2006) 3 22

Products for PDP1 Gene

Sources for PDP1 Gene