Aliases for PDIK1L Gene

Aliases for PDIK1L Gene

  • PDLIM1 Interacting Kinase 1 Like 2 3 5
  • CLIK1L 2 3 4
  • Serine/Threonine-Protein Kinase PDIK1L 3 4
  • EC 2.7.11.1 4 51
  • PDLIM1-Interacting Kinase 1-Like 4
  • Casein Kinase 3
  • STK35L2 3
  • PDIK1L 5

External Ids for PDIK1L Gene

Previous GeneCards Identifiers for PDIK1L Gene

  • GC01P026310
  • GC01P026437
  • GC01P024691

Summaries for PDIK1L Gene

GeneCards Summary for PDIK1L Gene

PDIK1L (PDLIM1 Interacting Kinase 1 Like) is a Protein Coding gene. Diseases associated with PDIK1L include Nail Disorder, Nonsyndromic Congenital, 4. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is STK35.

Additional gene information for PDIK1L Gene

No data available for Entrez Gene Summary , CIViC Summary , UniProtKB/Swiss-Prot Summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PDIK1L Gene

Genomics for PDIK1L Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PDIK1L Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PDIK1L on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PDIK1L

Top Transcription factor binding sites by QIAGEN in the PDIK1L gene promoter:
  • AP-1
  • ATF-2
  • c-Jun
  • PPAR-gamma1
  • PPAR-gamma2

Genomic Locations for PDIK1L Gene

Genomic Locations for PDIK1L Gene
chr1:26,109,131-26,125,555
(GRCh38/hg38)
Size:
16,425 bases
Orientation:
Plus strand
chr1:26,437,656-26,452,034
(GRCh37/hg19)
Size:
14,379 bases
Orientation:
Plus strand

Genomic View for PDIK1L Gene

Genes around PDIK1L on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PDIK1L Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PDIK1L Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PDIK1L Gene

Proteins for PDIK1L Gene

  • Protein details for PDIK1L Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8N165-PDK1L_HUMAN
    Recommended name:
    Serine/threonine-protein kinase PDIK1L
    Protein Accession:
    Q8N165
    Secondary Accessions:
    • B2R777
    • D3DPK2
    • Q5T2I0
    • Q8NDB3

    Protein attributes for PDIK1L Gene

    Size:
    341 amino acids
    Molecular mass:
    38546 Da
    Quaternary structure:
    No Data Available

neXtProt entry for PDIK1L Gene

Selected DME Specific Peptides for PDIK1L Gene

Q8N165:
  • WFVMDFCDGGDMN
  • RVAVKKIRC
  • MLAANPQDRPDAFELE
  • LVETSLKGEIAFDPRS
  • KQGTEIVPVGEALLENPKMEL
  • ERITFID
  • SQHPNVIHLEEC
  • DLKPDNIL
  • SVNKCFLSTACGTDFYMAPEVWEGHYTAKADIFALG
  • ELLIPVKKKSMN
  • WAMLERIT
  • DFYMAPEVWEGHYTAKADIFALGIIIWAM
  • RPDAFELELRLV

Post-translational modifications for PDIK1L Gene

  • Ubiquitination at Lys187
  • Modification sites at PhosphoSitePlus

Domains & Families for PDIK1L Gene

Gene Families for PDIK1L Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for PDIK1L Gene

Suggested Antigen Peptide Sequences for PDIK1L Gene

GenScript: Design optimal peptide antigens:
  • PDLIM1-interacting kinase 1-like (PDK1L_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q8N165

UniProtKB/Swiss-Prot:

PDK1L_HUMAN :
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
genes like me logo Genes that share domains with PDIK1L: view

Function for PDIK1L Gene

Molecular function for PDIK1L Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]; Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1;.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]; Xref=Rhea:RHEA:46608, Rhea:RHEA-COMP:11060, Rhea:RHEA-COMP:11605, ChEBI:CHEBI:15378, ChEBI:CHEBI:30013, ChEBI:CHEBI:30616, ChEBI:CHEBI:61977, ChEBI:CHEBI:456216; EC=2.7.11.1;.

Enzyme Numbers (IUBMB) for PDIK1L Gene

Phenotypes From GWAS Catalog for PDIK1L Gene

Gene Ontology (GO) - Molecular Function for PDIK1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IBA 21873635
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 22939624
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with PDIK1L: view
genes like me logo Genes that share phenotypes with PDIK1L: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PDIK1L

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PDIK1L

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PDIK1L Gene

Localization for PDIK1L Gene

Subcellular locations from UniProtKB/Swiss-Prot for PDIK1L Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PDIK1L gene
Compartment Confidence
nucleus 5
cytosol 2
plasma membrane 0
peroxisome 0

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PDIK1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IBA 21873635
GO:0005654 nucleoplasm IDA --
genes like me logo Genes that share ontologies with PDIK1L: view

Pathways & Interactions for PDIK1L Gene

PathCards logo

SuperPathways for PDIK1L Gene

No Data Available

Gene Ontology (GO) - Biological Process for PDIK1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0016310 phosphorylation IEA --
GO:0051321 meiotic cell cycle IBA 21873635
genes like me logo Genes that share ontologies with PDIK1L: view

No data available for Pathways by source and SIGNOR curated interactions for PDIK1L Gene

Drugs & Compounds for PDIK1L Gene

No Compound Related Data Available

Transcripts for PDIK1L Gene

mRNA/cDNA for PDIK1L Gene

3 REFSEQ mRNAs :
11 NCBI additional mRNA sequence :
4 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

CRISPR Products

Inhibitory RNA Products

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PDIK1L

Alternative Splicing Database (ASD) splice patterns (SP) for PDIK1L Gene

ExUns: 1a · 1b ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5a · 5b · 5c
SP1:
SP2: - -
SP3: - - -
SP4: -

Relevant External Links for PDIK1L Gene

GeneLoc Exon Structure for
PDIK1L

Expression for PDIK1L Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PDIK1L Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PDIK1L

SOURCE GeneReport for Unigene cluster for PDIK1L Gene:

Hs.468801

mRNA Expression by UniProt/SwissProt for PDIK1L Gene:

Q8N165-PDK1L_HUMAN
Tissue specificity: Expressed in liver, kidney, pancreas, spleen, thymus and prostate.

Evidence on tissue expression from TISSUES for PDIK1L Gene

  • Nervous system(4.3)
  • Lymph node(4.1)
genes like me logo Genes that share expression patterns with PDIK1L: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PDIK1L Gene

Orthologs for PDIK1L Gene

This gene was present in the common ancestor of animals.

Orthologs for PDIK1L Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PDIK1L 30 31
  • 100 (n)
OneToOne
Oppossum
(Monodelphis domestica)
Mammalia PDIK1L 31
  • 99 (a)
OneToOne
Cow
(Bos Taurus)
Mammalia PDIK1L 30 31
  • 97.36 (n)
OneToOne
Dog
(Canis familiaris)
Mammalia PDIK1L 30 31
  • 97.07 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Pdik1l 30 17 31
  • 93.35 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pdik1l 30
  • 92.96 (n)
Platypus
(Ornithorhynchus anatinus)
Mammalia PDIK1L 31
  • 82 (a)
OneToOne
Chicken
(Gallus gallus)
Aves PDIK1L 30 31
  • 83.68 (n)
OneToOne
Lizard
(Anolis carolinensis)
Reptilia PDIK1L 31
  • 96 (a)
OneToOne
Zebrafish
(Danio rerio)
Actinopterygii pdik1l 30 31
  • 72.43 (n)
OneToOne
Dr.16831 30
Worm
(Caenorhabditis elegans)
Secernentea zyg-1 31
  • 11 (a)
OneToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea CSA.8364 31
  • 51 (a)
OneToMany
Species where no ortholog for PDIK1L was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Fruit Fly (Drosophila melanogaster)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Tropical Clawed Frog (Silurana tropicalis)
  • Wheat (Triticum aestivum)

Evolution for PDIK1L Gene

ENSEMBL:
Gene Tree for PDIK1L (if available)
TreeFam:
Gene Tree for PDIK1L (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PDIK1L: view image

Paralogs for PDIK1L Gene

Paralogs for PDIK1L Gene

(1) SIMAP similar genes for PDIK1L Gene using alignment to 1 proteins:

  • PDK1L_HUMAN
genes like me logo Genes that share paralogs with PDIK1L: view

Variants for PDIK1L Gene

Additional dbSNP identifiers (rs#s) for PDIK1L Gene

Structural Variations from Database of Genomic Variants (DGV) for PDIK1L Gene

Variant ID Type Subtype PubMed ID
nsv511129 CNV loss 21212237
nsv819393 CNV loss 19587683
nsv950339 CNV duplication 24416366

Variation tolerance for PDIK1L Gene

Residual Variation Intolerance Score: 30.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.20; 4.39% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PDIK1L Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PDIK1L

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PDIK1L Gene

Disorders for PDIK1L Gene

MalaCards: The human disease database

(1) MalaCards diseases for PDIK1L Gene - From: DISEASES

Disorder Aliases PubMed IDs
nail disorder, nonsyndromic congenital, 4
  • ndnc4
- elite association - COSMIC cancer census association via MalaCards
genes like me logo Genes that share disorders with PDIK1L: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PDIK1L Gene

Publications for PDIK1L Gene

  1. Molecular cloning and characterization of a novel human kinase gene, PDIK1L. (PMID: 14631099) Guo L … Mao Y (Journal of genetics 2003) 2 3 4 23
  2. The DNA sequence and biological annotation of human chromosome 1. (PMID: 16710414) Gregory SG … Prigmore E (Nature 2006) 3 4
  3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
  4. A reference map of the human binary protein interactome. (PMID: 32296183) Luck K … Calderwood MA (Nature 2020) 3
  5. Architecture of the human interactome defines protein communities and disease networks. (PMID: 28514442) Huttlin EL … Harper JW (Nature 2017) 3

Products for PDIK1L Gene

Sources for PDIK1L Gene