Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PDIK1L Gene

Aliases for PDIK1L Gene

  • PDLIM1 Interacting Kinase 1 Like 2 3 5
  • EC 2.7.11.1 4 56
  • CLIK1L 3 4
  • Serine/Threonine-Protein Kinase PDIK1L 3
  • PDLIM1-Interacting Kinase 1-Like 4
  • Casein Kinase 3
  • STK35L2 3

External Ids for PDIK1L Gene

Previous GeneCards Identifiers for PDIK1L Gene

  • GC01P026310
  • GC01P026437
  • GC01P024691

Summaries for PDIK1L Gene

GeneCards Summary for PDIK1L Gene

PDIK1L (PDLIM1 Interacting Kinase 1 Like) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is STK35.

Additional gene information for PDIK1L Gene

No data available for Entrez Gene Summary , CIViC summary , UniProtKB/Swiss-Prot , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PDIK1L Gene

Genomics for PDIK1L Gene

GeneHancer (GH) Regulatory Elements for PDIK1L Gene

Promoters and enhancers for PDIK1L Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH01I026110 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 550.8 +1.2 1218 4.2 HDGF PKNOX1 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 POLR2B ZNF766 PDIK1L TRIM63 GPN2 GPATCH3 ARID1A LOC101928324 HMGN2 LOC101928728 SH3BGRL3 ENSG00000261349
GH01I026121 Enhancer 1.8 FANTOM5 Ensembl ENCODE dbSUPER 11.7 +14.1 14067 7.7 HDGF PKNOX1 CLOCK SMAD1 ARNT FEZF1 ZNF2 POLR2B ZNF766 ZNF302 ARID1A HMGN2 LOC101928324 ENSG00000261349 TRIM63 SYF2 GPN2 ZNF593 LOC101928728 RPL17P9
GH01I026145 Enhancer 1.1 Ensembl ENCODE 12.4 +34.1 34078 0.5 HDAC1 ELF3 ATF1 RB1 ARNT ARID4B SIN3A ZSCAN9 RAD21 CHAMP1 TRIM63 PDIK1L ZNF593 ENSG00000236782 SLC30A2 CD52 UBXN11 FAM110D LOC105376886
GH01I026348 Promoter/Enhancer 2.2 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 5.6 +243.8 243768 12.2 HDGF PKNOX1 FOXA2 MLX ARNT ARID4B SIN3A DMAP1 YY1 ZNF143 CRYBG2 CD52 UBXN11 CEP85 CNKSR1 LIN28A DHDDS SLC30A2 TRIM63 EXTL1
GH01I026077 Enhancer 1.1 ENCODE dbSUPER 11 -31.9 -31892 2.9 HDGF PKNOX1 ATF1 ARNT TCF12 ZNF766 E2F8 ATF7 CAVIN1 NCOA1 TRIM63 SLC30A2 PDIK1L ENSG00000252190 ENSG00000252691 GPN2 ENSG00000236782 ZNF593 FAM110D RSRP1
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around PDIK1L on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PDIK1L gene promoter:

Genomic Locations for PDIK1L Gene

Genomic Locations for PDIK1L Gene
chr1:26,111,165-26,125,548
(GRCh38/hg38)
Size:
14,384 bases
Orientation:
Plus strand
chr1:26,437,656-26,452,034
(GRCh37/hg19)

Genomic View for PDIK1L Gene

Genes around PDIK1L on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PDIK1L Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PDIK1L Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PDIK1L Gene

Proteins for PDIK1L Gene

  • Protein details for PDIK1L Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8N165-PDK1L_HUMAN
    Recommended name:
    Serine/threonine-protein kinase PDIK1L
    Protein Accession:
    Q8N165
    Secondary Accessions:
    • B2R777
    • D3DPK2
    • Q5T2I0
    • Q8NDB3

    Protein attributes for PDIK1L Gene

    Size:
    341 amino acids
    Molecular mass:
    38546 Da
    Quaternary structure:
    No Data Available

neXtProt entry for PDIK1L Gene

Selected DME Specific Peptides for PDIK1L Gene

Q8N165:
  • WFVMDFCDGGDMN
  • RVAVKKIRC
  • MLAANPQDRPDAFELE
  • LVETSLKGEIAFDPRS
  • KQGTEIVPVGEALLENPKMEL
  • ERITFID
  • SQHPNVIHLEEC
  • DLKPDNIL
  • SVNKCFLSTACGTDFYMAPEVWEGHYTAKADIFALG
  • ELLIPVKKKSMN
  • WAMLERIT
  • DFYMAPEVWEGHYTAKADIFALGIIIWAM
  • RPDAFELELRLV

Post-translational modifications for PDIK1L Gene

Domains & Families for PDIK1L Gene

Gene Families for PDIK1L Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted membrane proteins

Protein Domains for PDIK1L Gene

Suggested Antigen Peptide Sequences for PDIK1L Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q8N165

UniProtKB/Swiss-Prot:

PDK1L_HUMAN :
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
genes like me logo Genes that share domains with PDIK1L: view

Function for PDIK1L Gene

Molecular function for PDIK1L Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.

Enzyme Numbers (IUBMB) for PDIK1L Gene

Phenotypes From GWAS Catalog for PDIK1L Gene

Gene Ontology (GO) - Molecular Function for PDIK1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 25416956
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with PDIK1L: view
genes like me logo Genes that share phenotypes with PDIK1L: view

Animal Model Products

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PDIK1L Gene

Localization for PDIK1L Gene

Subcellular locations from UniProtKB/Swiss-Prot for PDIK1L Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PDIK1L gene
Compartment Confidence
nucleus 5
cytosol 2
plasma membrane 1
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PDIK1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005654 nucleoplasm IDA --
genes like me logo Genes that share ontologies with PDIK1L: view

Pathways & Interactions for PDIK1L Gene

SuperPathways for PDIK1L Gene

No Data Available

Gene Ontology (GO) - Biological Process for PDIK1L Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with PDIK1L: view

No data available for Pathways by source and SIGNOR curated interactions for PDIK1L Gene

Drugs & Compounds for PDIK1L Gene

No Compound Related Data Available

Transcripts for PDIK1L Gene

Unigene Clusters for PDIK1L Gene

PDLIM1 interacting kinase 1 like:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PDIK1L Gene

ExUns: 1a · 1b ^ 2a · 2b ^ 3 ^ 4a · 4b ^ 5a · 5b · 5c
SP1:
SP2: - -
SP3: - - -
SP4: -

Relevant External Links for PDIK1L Gene

GeneLoc Exon Structure for
PDIK1L
ECgene alternative splicing isoforms for
PDIK1L

Expression for PDIK1L Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PDIK1L Gene

NURSA nuclear receptor signaling pathways regulating expression of PDIK1L Gene:

PDIK1L

SOURCE GeneReport for Unigene cluster for PDIK1L Gene:

Hs.468801

mRNA Expression by UniProt/SwissProt for PDIK1L Gene:

Q8N165-PDK1L_HUMAN
Tissue specificity: Expressed in liver, kidney, pancreas, spleen, thymus and prostate.

Evidence on tissue expression from TISSUES for PDIK1L Gene

  • Nervous system(4.2)
  • Lymph node(4.1)
genes like me logo Genes that share expression patterns with PDIK1L: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PDIK1L Gene

Orthologs for PDIK1L Gene

This gene was present in the common ancestor of animals.

Orthologs for PDIK1L Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PDIK1L 33 34
  • 100 (n)
oppossum
(Monodelphis domestica)
Mammalia PDIK1L 34
  • 99 (a)
OneToOne
cow
(Bos Taurus)
Mammalia PDIK1L 33 34
  • 97.36 (n)
dog
(Canis familiaris)
Mammalia PDIK1L 33 34
  • 97.07 (n)
mouse
(Mus musculus)
Mammalia Pdik1l 33 16 34
  • 93.35 (n)
rat
(Rattus norvegicus)
Mammalia Pdik1l 33
  • 92.96 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PDIK1L 34
  • 82 (a)
OneToOne
chicken
(Gallus gallus)
Aves PDIK1L 33 34
  • 83.68 (n)
lizard
(Anolis carolinensis)
Reptilia PDIK1L 34
  • 96 (a)
OneToOne
zebrafish
(Danio rerio)
Actinopterygii pdik1l 33 34
  • 72.43 (n)
Dr.16831 33
worm
(Caenorhabditis elegans)
Secernentea zyg-1 34
  • 11 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.8364 34
  • 51 (a)
OneToMany
Species where no ortholog for PDIK1L was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for PDIK1L Gene

ENSEMBL:
Gene Tree for PDIK1L (if available)
TreeFam:
Gene Tree for PDIK1L (if available)

Paralogs for PDIK1L Gene

Paralogs for PDIK1L Gene

(1) SIMAP similar genes for PDIK1L Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with PDIK1L: view

Variants for PDIK1L Gene

Sequence variations from dbSNP and Humsavar for PDIK1L Gene

SNP ID Clin Chr 01 pos Variation AA Info Type
rs1000277872 -- 26,123,227(+) G/A 3_prime_UTR_variant
rs1000338922 -- 26,116,598(+) T/G intron_variant
rs1000392627 -- 26,116,295(+) A/G intron_variant
rs1000851931 -- 26,120,825(+) G/A intron_variant
rs1000880065 -- 26,121,372(+) A/G intron_variant

Structural Variations from Database of Genomic Variants (DGV) for PDIK1L Gene

Variant ID Type Subtype PubMed ID
nsv511129 CNV loss 21212237
nsv819393 CNV loss 19587683
nsv950339 CNV duplication 24416366

Variation tolerance for PDIK1L Gene

Residual Variation Intolerance Score: 30.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.20; 4.39% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PDIK1L Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PDIK1L

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PDIK1L Gene

Disorders for PDIK1L Gene

Additional Disease Information for PDIK1L

No disorders were found for PDIK1L Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PDIK1L Gene

Publications for PDIK1L Gene

  1. Molecular cloning and characterization of a novel human kinase gene, PDIK1L. (PMID: 14631099) Guo L … Mao Y (Journal of genetics 2003) 2 3 4 22 58
  2. The DNA sequence and biological annotation of human chromosome 1. (PMID: 16710414) Gregory SG … Prigmore E (Nature 2006) 3 4 58
  3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
  4. Architecture of the human interactome defines protein communities and disease networks. (PMID: 28514442) Huttlin EL … Harper JW (Nature 2017) 3 58
  5. A proteome-scale map of the human interactome network. (PMID: 25416956) Rolland T … Vidal M (Cell 2014) 3 58

Products for PDIK1L Gene

Sources for PDIK1L Gene

Content
Loading form....