The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulat... See more...

Aliases for PDE1B Gene

Aliases for PDE1B Gene

  • Phosphodiesterase 1B 2 3 5
  • Calcium/Calmodulin-Dependent 3',5'-Cyclic Nucleotide Phosphodiesterase 1B 3 4
  • Phosphodiesterase 1B, Calmodulin-Dependent 2 3
  • 63 KDa Cam-PDE 3 4
  • EC 3.1.4.17 4 50
  • Cam-PDE 1B 3 4
  • PDE1B1 3 4
  • PDES1B 3 4
  • Presumed 63kDa Form Of The Type 1 Cyclic Nucleotide Phosphodiesterase Family Known As PDE1B 3
  • Calcium/Calmodulin-Stimulated Cyclic Nucleotide Phosphodiesterase 3
  • Epididymis Secretory Sperm Binding Protein Li 79p 3
  • Calmodulin-Stimulated Phosphodiesterase PDE1B1 3
  • HEL-S-79p 3
  • EC 3.1.4 50
  • PDE1B 5

External Ids for PDE1B Gene

Previous HGNC Symbols for PDE1B Gene

  • PDES1B

Previous GeneCards Identifiers for PDE1B Gene

  • GC12P055070
  • GC12P054660
  • GC12P053229
  • GC12P054943
  • GC12P051981

Summaries for PDE1B Gene

Entrez Gene Summary for PDE1B Gene

  • The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

GeneCards Summary for PDE1B Gene

PDE1B (Phosphodiesterase 1B) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Sweet Taste Signaling. Gene Ontology (GO) annotations related to this gene include calmodulin binding and 3',5'-cyclic-AMP phosphodiesterase activity. An important paralog of this gene is PDE1C.

UniProtKB/Swiss-Prot Summary for PDE1B Gene

  • Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate.

Tocris Summary for PDE1B Gene

  • Phosphodiesterases (PDEs) are a family of phosphohydrolyases that catalyze the hydrolysis of 3' cyclic phosphate bonds in adenosine and/or guanine 3',5' cyclic monophosphate (cAMP and/or cGMP). PDEs regulate the second messengers by controlling their degradation.

Gene Wiki entry for PDE1B Gene

No data available for CIViC Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PDE1B Gene

Genomics for PDE1B Gene

GeneHancer (GH) Regulatory Elements Pubs

Promoters and enhancers for PDE1B Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH12J054559 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE CraniofacialAtlas 264.5 +11.6 11600 2.8 SP1 SMAD5 MBD2 TBP SKIL TAF1 PRDM10 ATF1 EHMT2 RFX5 PDE1B PPP1R1A piR-43106-044
GH12J054549 Promoter/Enhancer 1.9 EPDnew Ensembl ENCODE CraniofacialAtlas 250.7 +0.1 100 1.4 ZNF600 POLR2A ZIC2 ZBTB10 ZNF341 FOXA2 CTBP1 EBF1 ZNF843 ZBTB5 PDE1B ENSG00000258344 ATF7 PPP1R1A HNRNPA1 SCAT2 GTSF1 piR-43106-044
GH12J054548 Enhancer 0.2 FANTOM5 266.8 -1.5 -1476 0.2 PDE1B MK280109 NCKAP1L
GH12J054572 Enhancer 0.9 Ensembl ENCODE CraniofacialAtlas 19.2 +22.3 22317 2.6 CTCF MYNN RFX1 ZNF768 ZMYM3 SP1 RAD21 IKZF1 BMI1 PDE1B NCKAP1L piR-43106-044 PPP1R1A
GH12J054564 Enhancer 0.9 Ensembl ENCODE CraniofacialAtlas 10.1 +16.0 16000 3.2 NCOR1 TAL1 YY1 REST TCF12 ARID1B NANOG CBFA2T2 FOS ZBTB17 PPP1R1A PDE1B NCKAP1L piR-43106-044
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data from 2017 publication | Request up-to-date GeneHancer data (full dataset)

GeneHancers around PDE1B on the GeneHancer Hub at the UCSC Golden Path

Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PDE1B

Top Transcription factor binding sites by QIAGEN in the PDE1B gene promoter:
  • AREB6
  • ATF-2
  • CRE-BP1
  • FOXF2
  • MZF-1
  • Pax-2
  • Pax-2a
  • SREBP-1a
  • SREBP-1b

Genomic Locations for PDE1B Gene

Latest Assembly
chr12:54,549,601-54,579,239
(GRCh38/hg38)
Size:
29,639 bases
Orientation:
Plus strand

Previous Assembly
chr12:54,943,385-54,973,023
(GRCh37/hg19 by Entrez Gene)
Size:
29,639 bases
Orientation:
Plus strand

chr12:54,943,134-54,973,023
(GRCh37/hg19 by Ensembl)
Size:
29,890 bases
Orientation:
Plus strand

Genomic View for PDE1B Gene

Genes around PDE1B on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PDE1B Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PDE1B Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PDE1B Gene

Proteins for PDE1B Gene

  • Protein details for PDE1B Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q01064-PDE1B_HUMAN
    Recommended name:
    Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
    Protein Accession:
    Q01064
    Secondary Accessions:
    • Q92825
    • Q96KP3

    Protein attributes for PDE1B Gene

    Size:
    536 amino acids
    Molecular mass:
    61380 Da
    Cofactor:
    Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240;
    Quaternary structure:
    • Homodimer.

    Three dimensional structures from OCA and Proteopedia for PDE1B Gene

    Alternative splice isoforms for PDE1B Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PDE1B Gene

Selected DME Specific Peptides for PDE1B Gene

Q01064:
  • HAADVTQ
  • SVLENHH
  • VLATDMS
  • IHDYEHTG
  • SQIGFIDFIVEPT
  • LKKNLEY
  • KYKNPYHN
  • QGDKEAELGLPFSPLCDR
  • LISRFKIP
  • MKTALQQ
  • VYIDETR
  • EEFFRQGD
  • ESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGE
  • SIVHAVQAGIFVERM
  • YNDRSVLENHHISSVFR
  • LDTEDEL
  • IQENKQKWKERAASGITNQMSIDELSPCEEEAP
  • LHAADISHP
  • ATDMSCHFQQ

Post-translational modifications for PDE1B Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for PDE1B Gene

Gene Families for PDE1B Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for PDE1B Gene

GenScript: Design optimal peptide antigens:
  • cDNA FLJ53347, highly similar to Calcium/calmodulin-dependent 3',5'-cyclicnucleotide phosphodiesterase 1B (EC 3.1.4.17) (B4DK72_HUMAN)
  • 63 kDa Cam-PDE (PDE1B_HUMAN)

Graphical View of Domain Structure for InterPro Entry

Q01064

UniProtKB/Swiss-Prot:

PDE1B_HUMAN :
  • Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.
Family:
  • Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.
genes like me logo Genes that share domains with PDE1B: view

Function for PDE1B Gene

Molecular function for PDE1B Gene

UniProtKB/Swiss-Prot Function:
Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate.
UniProtKB/Swiss-Prot CatalyticActivity:
Reaction=a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+); Xref=Rhea:RHEA:14653, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:57867, ChEBI:CHEBI:58464; EC=3.1.4.17;.
UniProtKB/Swiss-Prot EnzymeRegulation:
Type I PDE are activated by the binding of calmodulin in the presence of Ca(2+).

Enzyme Numbers (IUBMB) for PDE1B Gene

Phenotypes From GWAS Catalog for PDE1B Gene

Gene Ontology (GO) - Molecular Function for PDE1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004112 cyclic-nucleotide phosphodiesterase activity IEA --
GO:0004114 3',5'-cyclic-nucleotide phosphodiesterase activity IBA 21873635
GO:0004115 3',5'-cyclic-AMP phosphodiesterase activity IDA 14687666
GO:0004117 calmodulin-dependent cyclic-nucleotide phosphodiesterase activity TAS 9419816
GO:0005515 protein binding IPI 21044950
genes like me logo Genes that share ontologies with PDE1B: view
genes like me logo Genes that share phenotypes with PDE1B: view

Animal Models for PDE1B Gene

MGI Knock Outs for PDE1B:

Animal Models for research

  • Taconic Biosciences Mouse Models for PDE1B

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PDE1B

Clone products for research

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PDE1B Gene

Localization for PDE1B Gene

Subcellular locations from UniProtKB/Swiss-Prot for PDE1B Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PDE1B gene
Compartment Confidence
cytosol 5
plasma membrane 1
extracellular 1
cytoskeleton 1
mitochondrion 1
nucleus 1
endoplasmic reticulum 1
lysosome 1

Gene Ontology (GO) - Cellular Components for PDE1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0043025 neuronal cell body IBA 21873635
genes like me logo Genes that share ontologies with PDE1B: view

No data available for Subcellular locations from the Human Protein Atlas (HPA) for PDE1B Gene

Pathways & Interactions for PDE1B Gene

PathCards logo

SuperPathways for PDE1B Gene

genes like me logo Genes that share pathways with PDE1B: view

Pathways by source for PDE1B Gene

1 BioSystems pathway for PDE1B Gene
10 Qiagen pathways for PDE1B Gene
  • Activation of cAMP-Dependent PKA
  • Activation of PKA through GPCR
  • Activation of PKC through GPCR
  • Bitter Taste Signaling
  • cAMP Pathway

Gene Ontology (GO) - Biological Process for PDE1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001505 regulation of neurotransmitter levels IEA --
GO:0001975 response to amphetamine IEA --
GO:0006915 apoptotic process TAS 8855339
GO:0007165 signal transduction IBA 21873635
GO:0007186 G protein-coupled receptor signaling pathway TAS --
genes like me logo Genes that share ontologies with PDE1B: view

No data available for SIGNOR curated interactions for PDE1B Gene

Drugs & Compounds for PDE1B Gene

(16) Drugs for PDE1B Gene - From: DrugBank, ApexBio, DGIdb, IUPHAR, and HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Bepridil Approved, Withdrawn Pharma Target, inhibitor 0
Felodipine Approved, Investigational Pharma Target, inhibitor 24
Nicardipine Approved, Investigational Pharma Target, inhibitor 44
Caffeine Approved Pharma Target, Target, inhibitor 658
Cilostazol Approved, Investigational Pharma PDE3 inhibitor 132

(5) Additional Compounds for PDE1B Gene - From: Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Eggmanone
505068-32-6
Etazolate hydrochloride
35838-58-5
IBMX
28822-58-4
MY-5445
78351-75-4
Ro 20-1724
29925-17-5

(5) Tocris Compounds for PDE1B Gene

Compound Action Cas Number
Eggmanone Potent and selective PDE4 inhibitor; suppresses hedgehog signaling 505068-32-6
Etazolate hydrochloride PDE4 inhibitor 35838-58-5
IBMX PDE inhibitor (non-selective) 28822-58-4
MY-5445 PDE5 inhibitor 78351-75-4
Ro 20-1724 PDE4 inhibitor 29925-17-5

(3) ApexBio Compounds for PDE1B Gene

Compound Action Cas Number
Cilostazol PDE3 inhibitor 73963-72-1
Sildenafil Citrate Treat erectile dysfunction and PAH 171599-83-0
Vinpocetine PDE inhibitor 42971-09-5
genes like me logo Genes that share compounds with PDE1B: view

Drug products for research

Transcripts for PDE1B Gene

mRNA/cDNA for PDE1B Gene

6 REFSEQ mRNAs :
17 NCBI additional mRNA sequence :
9 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :

Inhibitory RNAs for research

  • Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PDE1B

Clone products for research

Alternative Splicing Database (ASD) splice patterns (SP) for PDE1B Gene

ExUns: 1 ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12a · 12b ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17
SP1: - - - - - -
SP2: - - - -
SP3: - - -
SP4: - - - - - -
SP5: - - - -
SP6:
SP7: - - -
SP8: - - - - - - - - -

Relevant External Links for PDE1B Gene

GeneLoc Exon Structure for
PDE1B

Expression for PDE1B Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PDE1B Gene

mRNA differential expression in normal tissues according to GTEx for PDE1B Gene

This gene is overexpressed in Brain - Putamen (basal ganglia) (x10.8), Brain - Caudate (basal ganglia) (x9.0), and Brain - Nucleus accumbens (basal ganglia) (x8.0).

Protein differential expression in normal tissues from HIPED for PDE1B Gene

This gene is overexpressed in Urine (46.6) and Frontal cortex (9.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PDE1B Gene



Protein tissue co-expression partners for PDE1B Gene

Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PDE1B

SOURCE GeneReport for Unigene cluster for PDE1B Gene:

Hs.530871

Evidence on tissue expression from TISSUES for PDE1B Gene

  • Nervous system(4.9)
genes like me logo Genes that share expression patterns with PDE1B: view

Primer products for research

No data available for mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PDE1B Gene

Orthologs for PDE1B Gene

This gene was present in the common ancestor of animals.

Orthologs for PDE1B Gene

Organism Taxonomy Gene Similarity Type Details
Chimpanzee
(Pan troglodytes)
Mammalia PDE1B 29 30
  • 99.5 (n)
OneToOne
Cow
(Bos Taurus)
Mammalia PDE1B 29 30
  • 91.76 (n)
OneToOne
Mouse
(Mus musculus)
Mammalia Pde1b 29 16 30
  • 90.78 (n)
OneToOne
Rat
(Rattus norvegicus)
Mammalia Pde1b 29
  • 90.65 (n)
Dog
(Canis familiaris)
Mammalia PDE1B 29 30
  • 88.91 (n)
OneToOne
Platypus
(Ornithorhynchus anatinus)
Mammalia PDE1B 30
  • 58 (a)
OneToOne
Chicken
(Gallus gallus)
Aves PDE1B 30
  • 83 (a)
OneToOne
LOC777528 29
  • 80.76 (n)
Lizard
(Anolis carolinensis)
Reptilia PDE1B 30
  • 72 (a)
OneToOne
Tropical Clawed Frog
(Silurana tropicalis)
Amphibia pde1b 29
  • 74.55 (n)
Fruit Fly
(Drosophila melanogaster)
Insecta CG14940 31
  • 53 (a)
Pde1c 30
  • 21 (a)
OneToMany
Worm
(Caenorhabditis elegans)
Secernentea T04D3.3 31
  • 54 (a)
pde-1 30
  • 36 (a)
OneToMany
Sea Squirt
(Ciona savignyi)
Ascidiacea -- 30
  • 47 (a)
OneToMany
Species where no ortholog for PDE1B was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Eremothecium gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • Alpha proteobacteria (Wolbachia pipientis)
  • Amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • Baker's yeast (Saccharomyces cerevisiae)
  • Barley (Hordeum vulgare)
  • Beta proteobacteria (Neisseria meningitidis)
  • Bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • Common water flea (Daphnia pulex)
  • Corn (Zea mays)
  • E. coli (Escherichia coli)
  • Filamentous fungi (Aspergillus nidulans)
  • Firmicute Bacteria (Streptococcus pneumoniae)
  • Fission Yeast (Schizosaccharomyces pombe)
  • Green Algae (Chlamydomonas reinhardtii)
  • Honey Bee (Apis mellifera)
  • K. Lactis Yeast (Kluyveromyces lactis)
  • Loblloly Pine (Pinus taeda)
  • Malaria Parasite (Plasmodium falciparum)
  • Medicago Trunc (Medicago Truncatula)
  • Moss (Physcomitrella patens)
  • Oppossum (Monodelphis domestica)
  • Orangutan (Pongo pygmaeus)
  • Pig (Sus scrofa)
  • Rainbow Trout (Oncorhynchus mykiss)
  • Rice (Oryza sativa)
  • Rice Blast Fungus (Magnaporthe grisea)
  • Schistosome Parasite (Schistosoma mansoni)
  • Sea Anemone (Nematostella vectensis)
  • Sea Vase (Ciona intestinalis)
  • Sea Urchin (Strongylocentrotus purpuratus)
  • Sorghum (Sorghum bicolor)
  • Soybean (Glycine max)
  • Stem Rust Fungus (Puccinia graminis)
  • Sugarcane (Saccharum officinarum)
  • Thale Cress (Arabidopsis thaliana)
  • Tomato (Lycopersicon esculentum)
  • Toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • Wheat (Triticum aestivum)
  • Zebrafish (Danio rerio)

Evolution for PDE1B Gene

ENSEMBL:
Gene Tree for PDE1B (if available)
TreeFam:
Gene Tree for PDE1B (if available)
Aminode:
Evolutionary constrained regions (ECRs) for PDE1B: view image
Alliance of Genome Resources:
Additional Orthologs for PDE1B

Paralogs for PDE1B Gene

(11) SIMAP similar genes for PDE1B Gene using alignment to 3 proteins:

  • PDE1B_HUMAN
  • B4DK72_HUMAN
  • F8VZK3_HUMAN
genes like me logo Genes that share paralogs with PDE1B: view

Variants for PDE1B Gene

Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PDE1B Gene

SNP ID Clinical significance and condition Chr 12 pos Variation AA Info Type
rs151025806 Benign: not provided 54,569,358(+) C/T
NM_000924.4(PDE1B):c.402C>T (p.Phe134=)
SYNONYMOUS_VARIANT,FIVE_PRIME_UTR_VARIANT,INTRON

dbSNP identifiers (rs#s) for variants without ClinVar clinical significance for PDE1B Gene

All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).

Structural Variations from Database of Genomic Variants (DGV) for PDE1B Gene

Variant ID Type Subtype PubMed ID
nsv832421 CNV gain 17160897

Variation tolerance for PDE1B Gene

Residual Variation Intolerance Score: 20.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.97; 20.02% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for PDE1B Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PDE1B
Leiden Open Variation Database (LOVD)
PDE1B

SNP Genotyping and Copy Number Assays for research

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PDE1B Gene

Disorders for PDE1B Gene

Additional Disease Information for PDE1B

Human Genome Epidemiology Navigator
(HuGE)
Atlas
ATLAS of Genetics and Cytogenetics in Oncology and Haematology
Open Targets Platform
Open Targets Platform

No disorders were found for PDE1B Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PDE1B Gene

Publications for PDE1B Gene

  1. Identification and characterisation of a human calmodulin-stimulated phosphodiesterase PDE1B1. (PMID: 9419816) Yu J … Gelinas R (Cellular signalling 1997) 2 3 4 22
  2. Inhibition of calmodulin-dependent phosphodiesterase induces apoptosis in human leukemic cells. (PMID: 8855339) Jiang X … Epstein PM (Proceedings of the National Academy of Sciences of the United States of America 1996) 2 3 4 22
  3. Isolation and differential tissue distribution of two human cDNAs encoding PDE1 splice variants. (PMID: 11747989) Fidock M … Lanfear J (Cellular signalling 2002) 3 4 22
  4. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 40
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4

Products for PDE1B Gene

Sources for PDE1B Gene