Aliases for PCSK1 Gene
Aliases for PCSK1 Gene
External Ids for PCSK1 Gene
- HGNC: 8743
- Entrez Gene: 5122
- Ensembl: ENSG00000175426
- OMIM: 162150
- UniProtKB: P29120
Previous HGNC Symbols for PCSK1 Gene
- NEC1
Previous GeneCards Identifiers for PCSK1 Gene
- GC05M094956
- GC05M096190
- GC05M095754
- GC05M095800
- GC05M095751
- GC05M090916
Summaries for PCSK1 Gene
-
This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to subcellular compartments where a second autocatalytic even takes place and the catalytic activity is acquired. The protease is packaged into and activated in dense core secretory granules and expressed in the neuroendocrine system and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. It functions in the proteolytic activation of polypeptide hormones and neuropeptides precursors. Mutations in this gene have been associated with susceptibility to obesity and proprotein convertase 1/3 deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene [provided by RefSeq, Jan 2014]
GeneCards Summary for PCSK1 Gene
PCSK1 (Proprotein Convertase Subtilisin/Kexin Type 1) is a Protein Coding gene. Diseases associated with PCSK1 include Proprotein Convertase 1/3 Deficiency and Body Mass Index Quantitative Trait Locus 12. Among its related pathways are Peptide hormone metabolism and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase activity and endopeptidase activity. An important paralog of this gene is FURIN.
UniProtKB/Swiss-Prot for PCSK1 Gene
-
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin, insulin and AGRP.
Additional gene information for PCSK1 Gene
- Monarch Initiative
- Search for PCSK1 at DataMed
- Search for PCSK1 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PCSK1 Gene
Genomics for PCSK1 Gene
GeneHancer (GH) Regulatory Elements for PCSK1 Gene
Promoters and enhancers for PCSK1 Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data dump
GeneHancers around PCSK1 on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the PCSK1 gene promoter:
Regulatory Element Products
Genomic Locations for PCSK1 Gene
Genomic Locations for PCSK1 Gene
- chr5:96,390,336-96,434,143
- (GRCh38/hg38)
- Size:
- 43,808 bases
- Orientation:
- Minus strand
- chr5:95,726,040-95,769,847
- (GRCh37/hg19)
Genomic View for PCSK1 Gene
Genes around PCSK1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 5q15 by Ensembl
- 5q15 by Entrez Gene
- 5q15 by HGNC
PCSK1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for PCSK1 Gene
Proteins for PCSK1 Gene
-
Protein details for PCSK1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P29120-NEC1_HUMAN
- Recommended name:
- Neuroendocrine convertase 1
- Protein Accession:
- P29120
- B7Z8T7
- E9PHA1
- P78478
- Q92532
Protein attributes for PCSK1 Gene
- Size:
- 753 amino acids
- Molecular mass:
- 84152 Da
- Cofactor:
- Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
- Quaternary structure:
- No Data Available
Protein Expression for PCSK1 Gene
Selected DME Specific Peptides for PCSK1 Gene
- P29120:
-
- WKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEK
- GSIFVWA
- LTWRDMQHL
- HGTRCAGE
- FYNTKPYKHRDDRLLQAL
- GFGLLNA
- FEPRALKANGEVI
- HTGTSASAP
- ASYDFND
- ELGYDLLGQIGSLENHYLFKH
- LFNDPMWNQQWYLQDTRMTA
- NENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLD
- QNEGRIV
- WASGNGG
- CGVGVAY
- AMLRLLQSAFSKN
- NYDPEAS
- IGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGV
Post-translational modifications for PCSK1 Gene
- O-glycosylated.
- Glycosylation at Asn173, isoforms=2401, isoforms=2632, and Ser643
- Modification sites at PhosphoSitePlus
Other Protein References for PCSK1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for PCSK1
-
Abcam antibodies for PCSK1
-
Cloud-Clone Corp. Antibodies for PCSK1
- Invitrogen Antibodies for PCSK1
- GeneTex PCSK1 antibody for PCSK1
-
Santa Cruz Biotechnology (SCBT) Antibodies for PCSK1
- Sino Biological Antibodies for PCSK1
Protein Products
- R&D Systems Proteins and Enzymes for PCSK1 (Proprotein Convertase 1/PCSK1)
-
OriGene Purified Proteins for PCSK1
- Search Origene for MassSpec and Protein Over-expression Lysates for PCSK1
- Origene Custom Protein Services for PCSK1
- Sino Biological Cell Lysates for PCSK1
- Sino Biological Recombinant Proteins for PCSK1
-
Cloud-Clone Corp. Proteins for PCSK1
- Search GeneTex for Proteins for PCSK1
-
Abcam proteins for PCSK1
Assay Products
-
Cloud-Clone Corp. Assay Kits for PCSK1
Domains & Families for PCSK1 Gene
Gene Families for PCSK1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Disease related genes
- Enzymes
- Potential drug targets
- Predicted intracellular proteins
- Predicted secreted proteins
Protein Domains for PCSK1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for PCSK1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P29120- Family:
-
- Belongs to the peptidase S8 family. Furin subfamily.
Function for PCSK1 Gene
Molecular function for PCSK1 Gene
- GENATLAS Biochemistry:
- proprotein convertase subtilisin kexin-like 1,primarily expressed in tissues and cells containing secretory granules,localized in the Golgi apparatus and possibly in endosomes,specifically cleaving BDNF,susceptibility gene for non insulin dependent diabetes (type II) and coronary artery disease
- UniProtKB/Swiss-Prot CatalyticActivity:
- Release of protein hormones, neuropeptides and renin from their precursors, generally by hydrolysis of -Lys-Arg- - bonds.
- UniProtKB/Swiss-Prot Function:
- Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin, insulin and AGRP.
Enzyme Numbers (IUBMB) for PCSK1 Gene
Phenotypes From GWAS Catalog for PCSK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004252 | serine-type endopeptidase activity | ISS,TAS | -- |
| GO:0008233 | peptidase activity | IEA | -- |
| GO:0008236 | serine-type peptidase activity | IEA | -- |
| GO:0016787 | hydrolase activity | IEA | -- |
| GO:0042802 | identical protein binding | IEA | -- |
Phenotypes for PCSK1 Gene
- MGI mutant phenotypes for PCSK1:
-
inferred from 5 alleles
- homeostasis/metabolism phenotype
- muscle phenotype
- cardiovascular system phenotype
- mortality/aging
- immune system phenotype
- behavior/neurological phenotype
- growth/size/body region phenotype
- digestive/alimentary phenotype
- endocrine/exocrine gland phenotype
- reproductive system phenotype
- hematopoietic system phenotype
- adipose tissue phenotype
- limbs/digits/tail phenotype
- GenomeRNAi human phenotypes for PCSK1:
Animal Models for PCSK1 Gene
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for PCSK1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for PCSK1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for PCSK1 gene
- Search ViGene Biosciences for PCSK1
CRISPR Products
-
OriGene CRISPR knockouts for PCSK1
- genomics-online: gRNA clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
- Applied Biological Materials CRISPR for PCSK1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for PCSK1
- GenScript: Design CRISPR guide RNA sequences for PCSK1
miRNA for PCSK1 Gene
- miRTarBase miRNAs that target PCSK1
-
- hsa-mir-26b-5p (MIRT029995)
- hsa-mir-1185-1-3p (MIRT440017)
- hsa-mir-493-5p (MIRT440018)
- hsa-mir-1185-2-3p (MIRT440019)
- hsa-mir-485-5p (MIRT440020)
- hsa-mir-3942-3p (MIRT530359)
- hsa-mir-498 (MIRT530360)
- hsa-mir-4777-5p (MIRT530361)
- hsa-mir-526a (MIRT530362)
- hsa-mir-523-5p (MIRT530363)
- hsa-mir-522-5p (MIRT530364)
- hsa-mir-520c-5p (MIRT530365)
- hsa-mir-519c-5p (MIRT530366)
- hsa-mir-519b-5p (MIRT530367)
- hsa-mir-519a-5p (MIRT530368)
- hsa-mir-518f-5p (MIRT530369)
- hsa-mir-518e-5p (MIRT530370)
- hsa-mir-518d-5p (MIRT530371)
- hsa-mir-5100 (MIRT530372)
- hsa-mir-10b-3p (MIRT530373)
- hsa-mir-892c-5p (MIRT530374)
- hsa-mir-1179 (MIRT530375)
- hsa-mir-3156-5p (MIRT530376)
miRNA Products
- Search ViGene Biosciences for PCSK1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for PCSK1
- Browse OriGene Inhibitory RNA Products For PCSK1
- genomics-online: shRNA clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for PCSK1 gene
Clone Products
-
OriGene ORF clones in human for PCSK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for PCSK1
- VectorBuilder custom plasmid, inducible vectors for PCSK1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for PCSK1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for PCSK1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for PCSK1
-
ViGene Biosciences adenoviral particle packaged cDNA for PCSK1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for PCSK1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for PCSK1 gene
No data available for Transcription Factor Targets and HOMER Transcription for PCSK1 Gene
Localization for PCSK1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for PCSK1 Gene
- Cytoplasmic vesicle, secretory vesicle. Note=Localized in the secretion granules.
| Compartment | Confidence |
|---|---|
| extracellular | 5 |
| mitochondrion | 3 |
| golgi apparatus | 3 |
| nucleus | 2 |
| cytosol | 2 |
| endoplasmic reticulum | 1 |
| lysosome | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005615 | extracellular space | IDA | 8397508 |
| GO:0030133 | transport vesicle | IEA | -- |
| GO:0031410 | cytoplasmic vesicle | IEA | -- |
| GO:0034774 | secretory granule lumen | TAS | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for PCSK1 Gene
Pathways & Interactions for PCSK1 Gene
Pathways by source for PCSK1 Gene
8 Reactome pathways for PCSK1 Gene
1 R&D Systems pathway for PCSK1 Gene
1 Cell Signaling Technology pathway for PCSK1 Gene
Interacting Proteins for PCSK1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006508 | proteolysis | TAS | 9207799 |
| GO:0007267 | cell-cell signaling | TAS | 9207799 |
| GO:0008152 | metabolic process | TAS | 9207799 |
| GO:0016485 | protein processing | IEA | -- |
| GO:0016486 | peptide hormone processing | TAS | -- |
No data available for SIGNOR curated interactions for PCSK1 Gene
Drugs & Compounds for PCSK1 Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs |
|---|
Transcripts for PCSK1 Gene
mRNA/cDNA for PCSK1 Gene
- (3) REFSEQ mRNAs :
- (8) Additional mRNA sequences :
- (90) Selected AceView cDNA sequences:
- (4) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for PCSK1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for PCSK1
- genomics-online: gRNA clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
- Applied Biological Materials CRISPR for PCSK1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for PCSK1
- GenScript: Design CRISPR guide RNA sequences for PCSK1
miRNA Products
- Search ViGene Biosciences for PCSK1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for PCSK1
- Browse OriGene Inhibitory RNA Products For PCSK1
- genomics-online: shRNA clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for PCSK1 gene
Clone Products
-
OriGene ORF clones in human for PCSK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for PCSK1
- VectorBuilder custom plasmid, inducible vectors for PCSK1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for PCSK1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for PCSK1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
| ExUns: | 1 | ^ | 2a | · | 2b | ^ | 3 | ^ | 4 | ^ | 5a | · | 5b | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12a | · | 12b | ^ | 13 | ^ | 14 | ^ | 15 | ^ | 16 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||||
| SP2: | - | ||||||||||||||||||||||||||||||||||||
| SP3: | - |
Expression for PCSK1 Gene
mRNA differential expression in normal tissues according to GTEx for PCSK1 Gene
This gene is overexpressed in Brain - Hypothalamus (x14.5), Brain - Frontal Cortex (BA9) (x7.0), Brain - Anterior cingulate cortex (BA24) (x5.8), and Brain - Cortex (x4.6).
This gene is overexpressed in Islet of Langerhans (35.4), Peripheral blood mononuclear cells (12.0), and Cerebrospinal fluid (8.5).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for PCSK1 Gene
NURSA nuclear receptor signaling pathways regulating expression of PCSK1 Gene:
PCSK1SOURCE GeneReport for Unigene cluster for PCSK1 Gene:
Hs.78977Evidence on tissue expression from TISSUES for PCSK1 Gene
- Pancreas(3.6)
- Nervous system(3.3)
Phenotype-based relationships between genes and organs from Gene ORGANizer for PCSK1 Gene
Germ Layers:
- ectoderm
- endoderm
- mesoderm
Systems:
- cardiovascular
- digestive
- endocrine
- immune
- integumentary
- nervous
- reproductive
- skeletal muscle
Regions:
Head and neck:
- brain
- ear
- head
- pituitary gland
Thorax:
- breast
- esophagus
- heart
Abdomen:
- adrenal gland
- intestine
- large intestine
- pancreas
- small intestine
- stomach
Pelvis:
- ovary
- penis
- prostate
- testicle
- uterus
- vagina
- vulva
General:
- blood
- hair
- peripheral nerve
- peripheral nervous system
- skin
- sweat gland
- white blood cell
Primer Products
-
OriGene qPCR primer pairs for PCSK1
- genomics-online: primer clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners and mRNA Expression by UniProt/SwissProt for PCSK1 Gene
Orthologs for PCSK1 Gene
This gene was present in the common ancestor of animals and fungi.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | PCSK1 33 34 |
|
||
| dog (Canis familiaris) |
Mammalia | PCSK1 33 34 |
|
||
| cow (Bos Taurus) |
Mammalia | PCSK1 33 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Pcsk1 16 34 33 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | PCSK1 34 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | PCSK1 34 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | PCSK1 33 34 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | PCSK1 34 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | pcsk1 33 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | pcsk1 33 34 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | Fur1 35 34 |
|
||
| worm (Caenorhabditis elegans) |
Secernentea | bli-4 35 33 |
|
||
| kpc-1 35 |
|
|
|||
| aex-5 35 |
|
|
|||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | KEX2 34 |
|
OneToMany |
- Species where no ortholog for PCSK1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rat (Rattus norvegicus)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for PCSK1 Gene
Variants for PCSK1 Gene
Polymorphic Variants from UniProtKB/Swiss-Prot for PCSK1 Gene
- NEC1_HUMAN-P29120
- Genetic variations in PCSK1 define the body mass index quantitative trait locus 12 (BMIQ12) [MIM:612362]. Variance in body mass index is a susceptibility factor for obesity.
| SNP ID | Clin | Chr 05 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1034062614 | uncertain-significance, Proprotein convertase 1/3 deficiency, Monogenic Non-Syndromic Obesity | 96,391,089(-) | C/T | 3_prime_UTR_variant | |
| rs1042627744 | uncertain-significance, Monogenic Non-Syndromic Obesity, Proprotein convertase 1/3 deficiency | 96,392,913(-) | C/G | 3_prime_UTR_variant | |
| rs10515236 | uncertain-significance, Proprotein convertase 1/3 deficiency, Monogenic Non-Syndromic Obesity | 96,391,159(-) | C/T | 3_prime_UTR_variant | |
| rs115434587 | uncertain-significance, Proprotein convertase 1/3 deficiency, Monogenic Non-Syndromic Obesity | 96,392,404(-) | A/G | 3_prime_UTR_variant | |
| rs137852821 | pathogenic, Proprotein convertase 1/3 deficiency, Proprotein convertase 1 deficiency (PC1 deficiency) [MIM:600955] | 96,399,020(-) | C/T | coding_sequence_variant, missense_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| esv3570258 | CNV | loss | 25503493 |
| nsv1021263 | CNV | loss | 25217958 |
Residual Variation Intolerance Score:
24.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
8.25;
85.04% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for PCSK1 Gene
SNP Genotyping and Copy Number Assay Products
Disorders for PCSK1 Gene
(6) MalaCards diseases for PCSK1 Gene - From: HGMD, OMIM, ClinVar, GTR, Orphanet, Swiss-Prot, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| proprotein convertase 1/3 deficiency |
|
|
| body mass index quantitative trait locus 12 |
|
|
| hypoadrenalism |
|
|
| hyperproinsulinemia |
|
|
| kallmann syndrome |
|
Search PCSK1 in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
NEC1_HUMAN- Proprotein convertase 1 deficiency (PC1 deficiency) [MIM:600955]: Characterized by obesity, hypogonadism, hypoadrenalism, reactive hypoglycemia as well as marked small-intestinal absorptive dysfunction It is due to impaired processing of prohormones. {ECO:0000269 PubMed:14617756, ECO:0000269 PubMed:17595246, ECO:0000269 PubMed:9207799}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Additional Disease Information for PCSK1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No data available for Genatlas for PCSK1 Gene
Publications for PCSK1 Gene
- Obesity and impaired prohormone processing associated with mutations in the human prohormone convertase 1 gene. (PMID: 9207799) Jackson RS … O'Rahilly S (Nature genetics 1997) 3 4 22 44 58
- Common nonsynonymous variants in PCSK1 confer risk of obesity. (PMID: 18604207) Benzinou M … Froguel P (Nature genetics 2008) 3 4 44 58
- Small-intestinal dysfunction accompanies the complex endocrinopathy of human proprotein convertase 1 deficiency. (PMID: 14617756) Jackson RS … O'Rahilly S (The Journal of clinical investigation 2003) 3 4 22 58
- Human prohormone convertase 3 gene: exon-intron organization and molecular scanning for mutations in Japanese subjects with NIDDM. (PMID: 8666140) Ohagi S … Nanjo K (Diabetes 1996) 3 4 22 58
- Neuroendocrine-specific expression of the human prohormone convertase 1 gene. Hormonal regulation of transcription through distinct cAMP response elements. (PMID: 7797529) Jansen E … Van de Ven WJ (The Journal of biological chemistry 1995) 3 4 22 58
Products for PCSK1 Gene
- Browse R&D Systems for Antibodies
- R&D Systems Proteins and Enzymes for PCSK1 (Proprotein Convertase 1/PCSK1)
- Browse R&D Systems for biochemical assays
- Browse Human Proteins and Enzymes
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for PCSK1
- Search Origene for MassSpec and Protein Over-expression Lysates for PCSK1
- Origene Custom Protein Services for PCSK1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PCSK1
- Browse OriGene Inhibitory RNA Products For PCSK1
- OriGene qPCR primer pairs for PCSK1
- OriGene CRISPR knockouts for PCSK1
- OriGene ORF clones in human for PCSK1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For PCSK1
- GenScript: Next-day shipping of latest version cDNA ORF clones for PCSK1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for PCSK1
- GenScript Custom Assay Services for PCSK1
- GenScript Custom overexpressing Cell Line Services for PCSK1
- GenScript: Design CRISPR guide RNA sequences for PCSK1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for PCSK1
- Sino Biological Human cDNA Clone for PCSK1
- Sino Biological Cell Lysates for PCSK1
- Sino Biological Recombinant Proteins for PCSK1
- Sino Biological Antibodies for PCSK1
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for PCSK1
- Novus Biologicals lysates and proteins for PCSK1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for PCSK1
- Abcam proteins for PCSK1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Cloud-Clone Corp. Antibodies for PCSK1
- Cloud-Clone Corp. Proteins for PCSK1
- Cloud-Clone Corp. Assay Kits for PCSK1
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Cyagen custom Knockout/knockin (KOKI) mouse models for PCSK1
- VectorBuilder custom plasmid, inducible vectors for PCSK1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for PCSK1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 32 available PCSK1 Antibodies ranked by validation data
- Compare Top PCSK1 Antibodies
- antibodies-online: Search results for 8 available PCSK1 Elisa Kits ranked by validation data
- Compare Top PCSK1 Elisa Kits
- Recommended
- antibodies-online: Search results for 9 available PCSK1 Proteins ranked by validation data
- Compare Top PCSK1 Proteins
- GeneTex PCSK1 antibody for PCSK1
- Search GeneTex for Proteins for PCSK1
- ViGene Biosciences adenoviral particle packaged cDNA for PCSK1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for PCSK1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for PCSK1 gene
- Search ViGene Biosciences for PCSK1
- Santa Cruz Biotechnology (SCBT) Antibodies for PCSK1
- Search Santa Cruz Biotechnology (SCBT) for PCSK1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for PCSK1
- Horizon Cell Lines for PCSK1
- genomics-online: cdna clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
- orf clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
- genomics-online: gRNA clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
- genomics-online: primer clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
- genomics-online: shRNA clones - Search results for 124 available PCSK1 gene related products
- Overview of 124 available PCSK1 gene related products
Sources for PCSK1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew
- (158) Applied Biosystems