Free for academic non-profit institutions. Other users need a Commercial license
This gene encodes a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level. These two enzymes have similar organization of structural and functional domains. This enzyme is exclusively localized in the... See more...
Aliases for PAPOLG Gene
Aliases for PAPOLG Gene
External Ids for PAPOLG Gene
- HGNC: 14982
- NCBI Entrez Gene: 64895
- Ensembl: ENSG00000115421
- OMIM®: 616865
- UniProtKB/Swiss-Prot: Q9BWT3
Previous GeneCards Identifiers for PAPOLG Gene
- GC02P061111
- GC02P060941
- GC02P060957
- GC02P060895
- GC02P060836
- GC02P060983
- GC02P060725
Summaries for PAPOLG Gene
-
This gene encodes a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level. These two enzymes have similar organization of structural and functional domains. This enzyme is exclusively localized in the nucleus and exhibits both nonspecific and CPSF (cleavage and polyadenylation specificity factor)/AAUAAA-dependent polyadenylation activity. This gene is located on chromosome 2 in contrast to the PAPII gene, which is located on chromosome 14. [provided by RefSeq, Jul 2008]
GeneCards Summary for PAPOLG Gene
PAPOLG (Poly(A) Polymerase Gamma) is a Protein Coding gene. Diseases associated with PAPOLG include Chromosome 2P16.1-P15 Deletion Syndrome and Pyelitis. Among its related pathways are mRNA surveillance pathway. Gene Ontology (GO) annotations related to this gene include RNA binding and polynucleotide adenylyltransferase activity. An important paralog of this gene is PAPOLA.
UniProtKB/Swiss-Prot Summary for PAPOLG Gene
-
Responsible for the post-transcriptional adenylation of the 3'-terminal of mRNA precursors and several small RNAs including signal recognition particle (SRP) RNA, nuclear 7SK RNA, U2 small nuclear RNA, and ribosomal 5S RNA.
Additional gene information for PAPOLG Gene
- HGNC (14982)
- NCBI Entrez Gene (64895)
- Ensembl (ENSG00000115421)
- OMIM® (616865)
- UniProtKB/Swiss-Prot (Q9BWT3)
- Open Targets Platform(ENSG00000115421)
- Search for PAPOLG at DataMed
- Search for PAPOLG at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PAPOLG Gene
Genomics for PAPOLG Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for PAPOLG Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around PAPOLG on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PAPOLG
- Top Transcription factor binding sites by QIAGEN in the PAPOLG gene promoter:
-
- c-Ets-1
- E2F
- E2F-1
- E2F-2
- E2F-4
- E2F-5
Genomic Locations for PAPOLG Gene
Latest Assembly
- chr2:60,756,248-60,802,086
- (GRCh38/hg38)
- Size:
- 45,839 bases
- Orientation:
- Plus strand
Previous Assembly
- chr2:60,983,403-61,029,221
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 45,819 bases
- Orientation:
- Plus strand
- chr2:60,983,365-61,029,220
- (GRCh37/hg19 by Ensembl)
- Size:
- 45,856 bases
- Orientation:
- Plus strand
Genomic View for PAPOLG Gene
Genes around PAPOLG on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 2p16.1 by HGNC
- 2p16.1 by Entrez Gene
- 2p16.1 by Ensembl
PAPOLG Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for PAPOLG Gene
Proteins for PAPOLG Gene
-
Protein details for PAPOLG Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q9BWT3-PAPOG_HUMAN
- Recommended name:
- Poly(A) polymerase gamma
- Protein Accession:
- Q9BWT3
- B2RBH4
- Q59G05
- Q969N1
- Q9H8L2
- Q9HAD0
Protein attributes for PAPOLG Gene
- Size:
- 736 amino acids
- Molecular mass:
- 82803 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Cofactor:
- Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
- No Data Available
- SequenceCaution:
-
- Sequence=BAB14604.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
Protein Expression for PAPOLG Gene
Selected DME Specific Peptides for PAPOLG Gene
- Q9BWT3:
-
- KFFLVFS
- SLNGCRVTD
- PNFFQKY
- SESKNLP
- NLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
- WEWPNPVLLK
- CQLYPNA
- WAMLVAR
- DLTYDIQSFTDTVYRQA
- LEWVGLVESKIR
Post-translational modifications for PAPOLG Gene
Other Protein References for PAPOLG Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
-
Custom Antibody ServicesOriGene Antibodies for PAPOLG
- Novus Biologicals Antibodies for PAPOLG
-
Abcam antibodies for PAPOLG
- Invitrogen Antibodies for PAPOLG (AFLGC-PAPOLG)
-
Biorbyt antibodies for PAPOLG
-
Custom Antibody ServicesProSci Antibodies for PAPOLG
-
Santa Cruz Biotechnology (SCBT) Antibodies for PAPOLG
Protein products for research
-
OriGene Purified Proteins for PAPOLG
- Search Origene for MassSpec and Protein Over-expression Lysates for PAPOLG
- Origene Custom Protein Services for PAPOLG
Assay products for research
Domains & Families for PAPOLG Gene
Gene Families for PAPOLG Gene
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for PAPOLG Gene
- InterPro:
- Blocks:
-
- DNA polymerase, beta-like region
- Poly(A) polymerase, central region
- ProtoNet:
Suggested Antigen Peptide Sequences for PAPOLG Gene
- GenScript: Design optimal peptide antigens:
-
- SRP RNA 3'-adenylating enzyme (PAPOG_HUMAN)
- PAPOLG protein (Q05DB9_HUMAN)
- PAPOLG protein (Q2TAI9_HUMAN)
Graphical View of Domain Structure for InterPro Entry
Q9BWT3- Family:
-
- Belongs to the poly(A) polymerase family.
Function for PAPOLG Gene
Molecular function for PAPOLG Gene
- UniProtKB/Swiss-Prot Function:
- Responsible for the post-transcriptional adenylation of the 3'-terminal of mRNA precursors and several small RNAs including signal recognition particle (SRP) RNA, nuclear 7SK RNA, U2 small nuclear RNA, and ribosomal 5S RNA.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide; Xref=Rhea:RHEA:11332, Rhea:RHEA-COMP:11128, Rhea:RHEA-COMP:14647, ChEBI:CHEBI:30616, ChEBI:CHEBI:33019, ChEBI:CHEBI:83400, ChEBI:CHEBI:140626; EC=2.7.7.19; Evidence={ECO:0000269|PubMed:11287430, ECO:0000269|PubMed:11431479, ECO:0000269|PubMed:11463842};.
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=0.051 uM for poly(A)(15) {ECO:0000269|PubMed:11431479};
Enzyme Numbers (IUBMB) for PAPOLG Gene
Phenotypes From GWAS Catalog for PAPOLG Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0003723 | RNA binding | IEA | -- |
| GO:0004652 | polynucleotide adenylyltransferase activity | IEA,IDA | 11463842 |
| GO:0005524 | ATP binding | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
Phenotypes for PAPOLG Gene
- MGI mutant phenotypes for PAPOLG:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for PAPOLG:
-
- no effect
- Increased shRNA abundance (Z-score > 2)
- Decreased IL-8 secretion
- Decreased shRNA abundance (Z-score < -2)
- Decreased Aire reporter expression
- Decreased epidermal growth factor (EGF) endocytosis, decreased transferrin (TF) endocytosis
- Decreased viability in glioblastoma multiforme (GBM) lineage
- Increased homologous recombination repair frequency
Animal Models for research
-
Taconic Biosciences Mouse Models for PAPOLG
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for PAPOLG - Starting at $85 >
- * PAPOLG CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for PAPOLG
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLG
-
Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLG
miRNA for PAPOLG Gene
- miRTarBase miRNAs that target PAPOLG
-
- mmu-miR-17-5p (MIRT009952)
- mmu-miR-30e-5p (MIRT013285)
- mmu-miR-190a-5p (MIRT013591)
- hsa-miR-33a-5p (MIRT028237)
- hsa-miR-16-5p (MIRT031918)
- hsa-miR-503-5p (MIRT206833)
- hsa-miR-548e-5p (MIRT206834)
- hsa-miR-7158-3p (MIRT450780)
- hsa-miR-203b-3p (MIRT450781)
- hsa-miR-31-5p (MIRT450782)
- hsa-miR-1827 (MIRT450783)
- hsa-miR-4680-5p (MIRT450784)
- hsa-miR-4649-3p (MIRT450785)
- hsa-miR-4538 (MIRT450786)
- hsa-miR-3123 (MIRT450787)
- hsa-miR-4453 (MIRT450788)
- hsa-miR-549a (MIRT555838)
- hsa-miR-586 (MIRT555839)
- hsa-miR-5700 (MIRT555840)
- hsa-miR-33b-5p (MIRT555841)
- hsa-miR-3658 (MIRT566530)
- hsa-miR-3653-3p (MIRT566531)
- hsa-miR-5680 (MIRT566532)
- hsa-miR-4446-5p (MIRT614894)
- hsa-miR-5006-3p (MIRT614895)
- hsa-miR-4755-5p (MIRT614896)
- hsa-miR-6883-3p (MIRT614897)
- hsa-miR-561-3p (MIRT614898)
- hsa-miR-7844-5p (MIRT614899)
- hsa-miR-524-5p (MIRT636349)
- hsa-miR-520d-5p (MIRT636350)
- hsa-miR-1185-2-3p (MIRT641656)
- hsa-miR-1185-1-3p (MIRT641657)
- hsa-miR-4789-5p (MIRT641658)
- hsa-let-7f-2-3p (MIRT641659)
- hsa-miR-98-3p (MIRT641660)
- hsa-let-7f-1-3p (MIRT641661)
- hsa-let-7b-3p (MIRT641662)
- hsa-let-7a-3p (MIRT641663)
- hsa-miR-4666a-3p (MIRT641664)
- hsa-miR-381-3p (MIRT641665)
- hsa-miR-300 (MIRT641666)
- hsa-miR-653-5p (MIRT701081)
- hsa-miR-548s (MIRT701082)
- hsa-miR-6864-3p (MIRT701083)
- hsa-miR-3672 (MIRT701084)
- hsa-miR-653-3p (MIRT701085)
- hsa-miR-3926 (MIRT701086)
- hsa-miR-6851-5p (MIRT701087)
- hsa-miR-3689d (MIRT701088)
- hsa-miR-4711-5p (MIRT701089)
- hsa-miR-7112-3p (MIRT701090)
- hsa-miR-769-5p (MIRT701091)
- hsa-miR-4786-5p (MIRT701092)
- hsa-miR-3190-5p (MIRT701093)
- hsa-miR-6849-3p (MIRT701094)
- hsa-miR-4433a-3p (MIRT701095)
- hsa-miR-4459 (MIRT701096)
- hsa-miR-4768-3p (MIRT701097)
- hsa-miR-1294 (MIRT737178)
- hsa-miR-4252 (MIRT743335)
- hsa-miR-455-3p (MIRT746198)
- hsa-miR-5008-3p (MIRT749436)
- hsa-miR-5694 (MIRT751247)
- hsa-miR-6134 (MIRT752449)
- hsa-miR-6499-3p (MIRT752819)
- hsa-miR-6516-5p (MIRT753358)
- hsa-miR-6737-3p (MIRT754224)
- hsa-miR-7157-3p (MIRT759278)
- hsa-miR-7854-3p (MIRT759931)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PAPOLG
- Browse OriGene Inhibitory RNA Products For PAPOLG
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLG
Clone products for research
- Applied Biological Materials (abm): Clones for PAPOLG - Starting at $45 >
- * PAPOLG as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for PAPOLG
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLG
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PAPOLG Gene
Localization for PAPOLG Gene
Subcellular locations from UniProtKB/Swiss-Prot for PAPOLG Gene
- Nucleus.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 4 |
| plasma membrane | 1 |
| extracellular | 1 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
- Nucleoplasm (4)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IEA,IDA | 11463842 |
| GO:0005654 | nucleoplasm | IDA | -- |
| GO:0005829 | cytosol | IDA | -- |
| GO:0016020 | membrane | HDA | 19946888 |
| GO:0016604 | nuclear body | IDA | -- |
Pathways & Interactions for PAPOLG Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | mRNA surveillance pathway | ||
Pathways by source for PAPOLG Gene
1 KEGG pathway for PAPOLG Gene
Interacting Proteins for PAPOLG Gene
GPS-Prot Interaction Network for PAPOLG
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006378 | mRNA polyadenylation | IBA | 21873635 |
| GO:0006397 | mRNA processing | IEA | -- |
| GO:0031123 | RNA 3'-end processing | IEA | -- |
| GO:0043631 | RNA polyadenylation | IEA,IDA | 11287430 |
No data available for SIGNOR curated interactions for PAPOLG Gene
Drugs & Compounds for PAPOLG Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| pyrophosphate |
|
14000-31-8 |
|
Transcripts for PAPOLG Gene
mRNA/cDNA for PAPOLG Gene
- 1 REFSEQ mRNAs :
- 19 NCBI additional mRNA sequence :
- 7 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000238714 7348 nts (view in UCSC)
- ENST00000412217 6074 nts (view in UCSC)
- ENST00000414060 3511 nts (view in UCSC)
- ENST00000453839 3324 nts (view in UCSC)
- ENST00000470208 686 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for PAPOLG - Starting at $85 >
- * PAPOLG CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for PAPOLG
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLG
-
Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLG
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PAPOLG
- Browse OriGene Inhibitory RNA Products For PAPOLG
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLG
Clone products for research
- Applied Biological Materials (abm): Clones for PAPOLG - Starting at $45 >
- * PAPOLG as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for PAPOLG
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLG
| ExUns: | 1a | · | 1b | · | 1c | ^ | 2 | ^ | 3a | · | 3b | ^ | 4 | ^ | 5a | · | 5b | ^ | 6 | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10a | · | 10b | ^ | 11a | · | 11b | ^ | 12 | ^ | 13 | ^ | 14a | · | 14b | ^ | 15 | ^ | 16 | ^ | 17a | · | 17b | ^ | 18a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: |
| ExUns: | 18b | ^ | 19 | ^ | 20a | · | 20b |
|---|---|---|---|---|---|---|---|
| SP1: | |||||||
| SP2: | |||||||
| SP3: | |||||||
| SP4: | |||||||
| SP5: | |||||||
| SP6: | |||||||
| SP7: | |||||||
| SP8: |
Relevant External Links for PAPOLG Gene
- GeneLoc Exon Structure for
- PAPOLG
Expression for PAPOLG Gene
This gene is overexpressed in Pancreatic juice (40.1), Adipocyte (10.8), and Testis (8.9).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PAPOLG Gene
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PAPOLG
SOURCE GeneReport for Unigene cluster for PAPOLG Gene:
Hs.387471mRNA Expression by UniProt/SwissProt for PAPOLG Gene:
Q9BWT3-PAPOG_HUMAN
Tissue specificity:
Expressed predominantly in testis, and weakly in other tissues. Overexpressed in several tumors.
Evidence on tissue expression from TISSUES for PAPOLG Gene
- Nervous system(4.5)
- Blood(2.3)
Primer products for research
-
OriGene qPCR primer pairs for PAPOLG
Gene Expression Assays for research
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for PAPOLG Gene
Orthologs for PAPOLG Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | PAPOLG 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | PAPOLG 30 31 |
|
OneToOne | |
| Cow (Bos Taurus) |
Mammalia | PAPOLG 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Papolg 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Papolg 30 |
|
||
| Oppossum (Monodelphis domestica) |
Mammalia | PAPOLG 31 |
|
OneToOne | |
| Platypus (Ornithorhynchus anatinus) |
Mammalia | PAPOLG 31 |
|
OneToOne | |
| Chicken (Gallus gallus) |
Aves | PAPOLG 30 31 |
|
OneToOne | |
| Lizard (Anolis carolinensis) |
Reptilia | -- 31 |
|
OneToMany | |
| -- 31 |
|
OneToMany | |||
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | papolg 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | papolg 30 31 |
|
OneToOne | |
| zgc63762 30 |
|
||||
| Rainbow Trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.6689 30 |
|
||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP013207 30 |
|
||
| Fruit Fly (Drosophila melanogaster) |
Insecta | hrg 30 31 32 |
|
OneToMany | |
| Worm (Caenorhabditis elegans) |
Secernentea | F43G6.5 31 |
|
ManyToMany | |
| Y32F6A.3 32 |
|
|
|||
| T15H9.6 31 32 |
|
ManyToMany | |||
| pap-1 31 |
|
ManyToMany | |||
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | PAP1 30 31 33 |
|
OneToMany | |
| K. Lactis Yeast (Kluyveromyces lactis) |
Saccharomycetes | KLLA0B13255g 30 |
|
||
| A. gosspyii yeast (Eremothecium gossypii) |
Saccharomycetes | AGOS_ABL002C 30 |
|
||
| Thale Cress (Arabidopsis thaliana) |
eudicotyledons | PAPS1 30 |
|
||
| Rice (Oryza sativa) |
Liliopsida | Os06g0319600 30 |
|
||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.2725 31 |
|
OneToMany | |
| Fission Yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | pla1 30 |
|
||
| Bread mold (Neurospora crassa) |
Ascomycetes | NCU08983 30 |
|
- Species where no ortholog for PAPOLG was found in the sources mined by GeneCards:
-
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for PAPOLG Gene
- ENSEMBL:
- Gene Tree for PAPOLG (if available)
- TreeFam:
- Gene Tree for PAPOLG (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for PAPOLG: view image
Paralogs for PAPOLG Gene
Variants for PAPOLG Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PAPOLG Gene
| SNP ID | Clinical significance and condition | Chr 02 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs1449808552 | Benign: not provided | 60,782,678(+) |
TAA/T NM_022894.4(PAPOLG):c.1028-7_1028-6del |
INTRON | |
| rs1553378906 | Benign: not provided. Likely Benign: not provided | 60,782,680(+) |
A/ATTTTTTTTTTTTT
A/ATTTTTTTTTTTTT
NM_022894.4(PAPOLG):c.1028-3_1028-2insTTTTTTTTTTTTTT |
INTRON |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv3859n100 | CNV | gain | 25217958 |
| dgv6908n54 | CNV | gain | 21841781 |
| esv3591007 | CNV | gain | 21293372 |
| esv3591008 | CNV | loss | 21293372 |
| nsv834215 | CNV | loss | 17160897 |
Residual Variation Intolerance Score:
3.85% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
1.03;
21.17% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for PAPOLG Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- PAPOLG
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PAPOLG Gene
Disorders for PAPOLG Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| chromosome 2p16.1-p15 deletion syndrome |
|
|
| pyelitis |
|
|
| peroxisome biogenesis disorder 11a |
|
|
| myasthenic syndrome, congenital, 6, presynaptic |
|
|
| acute cystitis |
|
|
Search PAPOLG in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for PAPOLG
- Genetic Association Database
- (GAD)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for PAPOLG Gene
Publications for PAPOLG Gene
- A novel nuclear human poly(A) polymerase (PAP), PAP gamma. (PMID: 11431479) Kyriakopoulou CB … Virtanen A (The Journal of biological chemistry 2001) 3 4 23
- Crystal structure of human poly(A) polymerase gamma reveals a conserved catalytic core for canonical poly(A) polymerases. (PMID: 24076191) Yang Q … Doublié S (Journal of molecular biology 2014) 3 4
- Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
- Purification, characterization, and cloning of the cDNA of human signal recognition particle RNA 3'-adenylating enzyme. (PMID: 11287430) Perumal K … Reddy R (The Journal of biological chemistry 2001) 3 4
ExternalLinks
Products for PAPOLG Gene
- Custom Antibody ServicesOriGene Antibodies for PAPOLG
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for PAPOLG
- Search Origene for MassSpec and Protein Over-expression Lysates for PAPOLG
- Origene Custom Protein Services for PAPOLG
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PAPOLG
- Browse OriGene Inhibitory RNA Products For PAPOLG
- OriGene qPCR primer pairs for PAPOLG
- OriGene CRISPR knockouts for PAPOLG
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For PAPOLG
- Sino Biological Human cDNA Clone for PAPOLG
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for PAPOLG
- Novus Biologicals proteins and lysates for PAPOLG
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for PAPOLG
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Taconic Biosciences Mouse Models for PAPOLG
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for PAPOLG (AFLGC-PAPOLG)
- VectorBuilder Custom and pre-made DNA vectors for PAPOLG (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for PAPOLG (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for PAPOLG (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for PAPOLG CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for PAPOLG
- antibodies-online: Show 11 available PAPOLG Antibodies ranked by validation data
- Compare Top PAPOLG Antibodies
- antibodies-online: Search results for available PAPOLG related products ranked by validation data
- antibodies-online: Search results for available PAPOLG related products ranked by validation data
- Santa Cruz Biotechnology (SCBT) Antibodies for PAPOLG
- Search Santa Cruz Biotechnology (SCBT) for PAPOLG siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLG
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLG
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLG
- Search GeneCopoeia for miRNA 3'UTR Target clone products for PAPOLG
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLG
- Biorbyt antibodies for PAPOLG
Sources for PAPOLG Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Mar-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) MedlinePlus Genetics
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNAcentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Open Targets Platform
- (175) 5SRRNADB
- (176) snoDB
- (177) MirGeneDB