Free for academic non-profit institutions. Other users need a Commercial license
The protein encoded by this gene belongs to the poly(A) polymerase family. It is required for the addition of adenosine residues for the creation of the 3'-poly(A) tail of mRNAs. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] See more...
Aliases for PAPOLA Gene
Aliases for PAPOLA Gene
External Ids for PAPOLA Gene
- HGNC: 14981
- NCBI Entrez Gene: 10914
- Ensembl: ENSG00000090060
- OMIM®: 605553
- UniProtKB/Swiss-Prot: P51003
Previous GeneCards Identifiers for PAPOLA Gene
- GC14P094479
- GC14P090785
- GC14P094958
- GC14P096038
- GC14P096969
- GC14P077153
Summaries for PAPOLA Gene
-
The protein encoded by this gene belongs to the poly(A) polymerase family. It is required for the addition of adenosine residues for the creation of the 3'-poly(A) tail of mRNAs. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
GeneCards Summary for PAPOLA Gene
PAPOLA (Poly(A) Polymerase Alpha) is a Protein Coding gene. Diseases associated with PAPOLA include 46,Xx Sex Reversal 3 and Developmental And Epileptic Encephalopathy 1. Among its related pathways are mRNA Splicing - Major Pathway and Processing of Capped Intronless Pre-mRNA. Gene Ontology (GO) annotations related to this gene include RNA binding and manganese ion binding. An important paralog of this gene is PAPOLB.
UniProtKB/Swiss-Prot Summary for PAPOLA Gene
-
Polymerase that creates the 3'-poly(A) tail of mRNA's. Also required for the endoribonucleolytic cleavage reaction at some polyadenylation sites. May acquire specificity through interaction with a cleavage and polyadenylation specificity factor (CPSF) at its C-terminus.
Additional gene information for PAPOLA Gene
- HGNC (14981)
- NCBI Entrez Gene (10914)
- Ensembl (ENSG00000090060)
- OMIM® (605553)
- UniProtKB/Swiss-Prot (P51003)
- Open Targets Platform(ENSG00000090060)
- Search for PAPOLA at DataMed
- Search for PAPOLA at HumanCyc
No data available for CIViC Summary , Tocris Summary , PharmGKB "VIP" Summary , Rfam classification and piRNA Summary for PAPOLA Gene
Genomics for PAPOLA Gene
GeneHancer (GH) Regulatory Elements Pubs
Promoters and enhancers for PAPOLA Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around PAPOLA on the GeneHancer Hub at the UCSC Golden Path
Cistromic (ChIP-Seq) regulation report from SPP (The Signaling Pathways Project) for PAPOLA
- Top Transcription factor binding sites by QIAGEN in the PAPOLA gene promoter:
-
- AhR
- AML1a
- AP-1
- Arnt
- c-Fos
- c-Jun
- Egr-2
- FOXO4
- MRF-2
- Sox5
Genomic Locations for PAPOLA Gene
Latest Assembly
- chr14:96,501,433-96,567,116
- (GRCh38/hg38)
- Size:
- 65,684 bases
- Orientation:
- Plus strand
Previous Assembly
- chr14:96,968,713-97,033,453
- (GRCh37/hg19 by Entrez Gene)
- Size:
- 64,741 bases
- Orientation:
- Plus strand
- chr14:96,967,770-97,033,448
- (GRCh37/hg19 by Ensembl)
- Size:
- 65,679 bases
- Orientation:
- Plus strand
Genomic View for PAPOLA Gene
Genes around PAPOLA on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 14q32.2 by HGNC
- 14q32.2 by Entrez Gene
- 14q32.2 by Ensembl
PAPOLA Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for PAPOLA Gene
Proteins for PAPOLA Gene
-
Protein details for PAPOLA Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P51003-PAPOA_HUMAN
- Recommended name:
- Poly(A) polymerase alpha
- Protein Accession:
- P51003
- Q86SX4
- Q86TV0
- Q8IYF5
- Q9BVU2
Protein attributes for PAPOLA Gene
- Size:
- 745 amino acids
- Molecular mass:
- 82843 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
- Cofactor:
- Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Monomer. Found in a complex with CPSF1, FIP1L1 and PAPOLA. Interacts with AHCYL1 and FIP1L1; the interaction with AHCYL1 seems to increase interaction with FIP1L1 (PubMed:19224921). Interacts with NUDT21; the interaction is diminished by acetylation. Interacts with KPNB1; the interaction promotes PAP nuclear import and is inhibited by acetylation of PAP (By similarity).
Protein Expression for PAPOLA Gene
Selected DME Specific Peptides for PAPOLA Gene
- P51003:
-
- KFFLVFS
- SLNGCRVTD
- QEEVKDLR
- QSVIENV
- FFQKYKHYIVLLASA
- SPISLAAPK
- PNFFQKY
- PFGVFEEEEELQRRIL
- NSMSVPS
- LRAIKLWA
- SESKNLP
- LPQSVIENVGGKIFTFG
- IYSNILGFLGGVSWA
- NLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
- EESPKKTKTEEDE
- WEWPNPVLLK
- ENSENLSVDLTYDIQSFTDTV
- CQLYPNA
- KAEWSKLF
- SSTDLSDI
- WAMLVAR
- EEFRTMWVIGL
- DLTYDIQSFTDTVYRQA
- LEWVGLVESKIR
Post-translational modifications for PAPOLA Gene
- Polysumoylated. Varying sumolyation depending on tissue- and cell-type. Highly sumoylated in bladder and NIH 3T3 cells. Sumoylation is required for nuclear localization and enhances PAP stability. Desumoylated by SENP1. Inhibits polymerase activity (By similarity).
- Hyperphosphorylation on multiple CDK2 consensus and non-consensus sites in the C-terminal Ser/Thr-rich region represses PAP activity in late M-phase. Phosphorylation/dephosphorylation may regulate the interaction between PAP and CPSF (By similarity).
- Acetylated in the C-terminus. Acetylation decreases interaction with NUDT21 and KPNB1, and inhibits nuclear localization through inhibiting binding to the importin alpha/beta complex (By similarity).
-
Ubiquitination at Lys67 and Lys360
- NX_P51003 (NX_P51003-1)
- Modification sites at PhosphoSitePlus
Other Protein References for PAPOLA Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibodies for research
-
Custom Antibody ServicesOriGene Antibodies for PAPOLA
- Novus Biologicals Antibodies for PAPOLA
-
Abcam antibodies for PAPOLA
- Invitrogen Antibodies for PAPOLA (AFLGC-PAPOLA)
-
Boster Bio Antibodies for PAPOLA
-
Custom Antibody ServicesProSci Antibodies for PAPOLA
-
Santa Cruz Biotechnology (SCBT) Antibodies for PAPOLA
- Sino Biological Antibodies for PAPOLA
Protein products for research
-
OriGene Purified Proteins for PAPOLA
- Search Origene for MassSpec and Protein Over-expression Lysates for PAPOLA
- Origene Custom Protein Services for PAPOLA
- antibodies-online: Show 8 available PAPOLA Proteins ranked by validation data
- Compare Top PAPOLA Proteins
-
Quality Products:
-
Abcam proteins for PAPOLA
Assay products for research
Domains & Families for PAPOLA Gene
Gene Families for PAPOLA Gene
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for PAPOLA Gene
- InterPro:
- Blocks:
-
- DNA polymerase, beta-like region
- Poly(A) polymerase, central region
- ProtoNet:
Suggested Antigen Peptide Sequences for PAPOLA Gene
- GenScript: Design optimal peptide antigens:
-
- Polynucleotide adenylyltransferase alpha (PAPOA_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P51003- Family:
-
- Belongs to the poly(A) polymerase family.
Function for PAPOLA Gene
Molecular function for PAPOLA Gene
- UniProtKB/Swiss-Prot Function:
- Polymerase that creates the 3'-poly(A) tail of mRNA's. Also required for the endoribonucleolytic cleavage reaction at some polyadenylation sites. May acquire specificity through interaction with a cleavage and polyadenylation specificity factor (CPSF) at its C-terminus.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide; Xref=Rhea:RHEA:11332, Rhea:RHEA-COMP:11128, Rhea:RHEA-COMP:14647, ChEBI:CHEBI:30616, ChEBI:CHEBI:33019, ChEBI:CHEBI:83400, ChEBI:CHEBI:140626; EC=2.7.7.19;.
Enzyme Numbers (IUBMB) for PAPOLA Gene
Phenotypes From GWAS Catalog for PAPOLA Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000166 | nucleotide binding | IEA | -- |
| GO:0000287 | magnesium ion binding | ISS | -- |
| GO:0003723 | RNA binding | IEA | -- |
| GO:0004652 | polynucleotide adenylyltransferase activity | IEA,TAS | -- |
| GO:0005515 | protein binding | IPI | 7590244 |
Phenotypes for PAPOLA Gene
- MGI mutant phenotypes for PAPOLA:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for PAPOLA:
Animal Models for research
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for PAPOLA - Starting at $85 >
- * PAPOLA CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for PAPOLA
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLA
-
Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLA
miRNA for PAPOLA Gene
- miRTarBase miRNAs that target PAPOLA
-
- hsa-miR-155-5p (MIRT005093)
- mmu-miR-758-3p (MIRT007546)
- mmu-miR-301b-3p (MIRT007816)
- mmu-miR-425-5p (MIRT008564)
- mmu-miR-340-5p (MIRT010360)
- mmu-miR-149-5p (MIRT014452)
- hsa-miR-130b-3p (MIRT020257)
- hsa-miR-93-5p (MIRT028127)
- hsa-miR-877-5p (MIRT037348)
- hsa-miR-320a (MIRT044470)
- hsa-let-7b-5p (MIRT052114)
- hsa-miR-1910-3p (MIRT192128)
- hsa-miR-6511a-5p (MIRT192135)
- hsa-miR-4662a-5p (MIRT441375)
- hsa-miR-153-5p (MIRT441376)
- hsa-miR-3065-5p (MIRT441377)
- hsa-miR-7-2-3p (MIRT441378)
- hsa-miR-7-1-3p (MIRT441379)
- hsa-miR-6516-5p (MIRT471617)
- hsa-miR-6807-5p (MIRT471618)
- hsa-miR-455-3p (MIRT471619)
- hsa-miR-650 (MIRT471620)
- hsa-miR-3612 (MIRT471621)
- hsa-miR-4327 (MIRT471622)
- hsa-miR-6499-3p (MIRT471623)
- hsa-miR-1827 (MIRT471624)
- hsa-miR-665 (MIRT471625)
- hsa-miR-4459 (MIRT471626)
- hsa-miR-4695-5p (MIRT471627)
- hsa-miR-8485 (MIRT609226)
- hsa-miR-6780a-5p (MIRT629186)
- hsa-miR-6779-5p (MIRT629187)
- hsa-miR-3689c (MIRT629188)
- hsa-miR-3689b-3p (MIRT629189)
- hsa-miR-3689a-3p (MIRT629190)
- hsa-miR-30b-3p (MIRT629191)
- hsa-miR-1273h-5p (MIRT629192)
- hsa-miR-7977 (MIRT629193)
- hsa-miR-6799-5p (MIRT629194)
- hsa-miR-6883-5p (MIRT629195)
- hsa-miR-6785-5p (MIRT629196)
- hsa-miR-4728-5p (MIRT629197)
- hsa-miR-149-3p (MIRT629198)
- hsa-miR-7106-5p (MIRT629199)
- hsa-miR-24-3p (MIRT629200)
- hsa-miR-4284 (MIRT629201)
- hsa-miR-2277-3p (MIRT629202)
- hsa-miR-4526 (MIRT629203)
- hsa-miR-3660 (MIRT629204)
- hsa-miR-383-3p (MIRT629205)
- hsa-miR-6871-5p (MIRT629206)
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PAPOLA
- Browse OriGene Inhibitory RNA Products For PAPOLA
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA
Clone products for research
- Applied Biological Materials (abm): Clones for PAPOLA - Starting at $45 >
- * PAPOLA as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for PAPOLA
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLA
Cell Lines for research
-
Horizon Cell Lines for PAPOLA
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PAPOLA Gene
Localization for PAPOLA Gene
Subcellular locations from UniProtKB/Swiss-Prot for PAPOLA Gene
- Cytoplasm. Nucleus. Note=The 90 kDa form is nuclear while the 100 kDa and the 106 kDa forms are both nuclear and cytoplasmic.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 2 |
| plasma membrane | 1 |
| extracellular | 1 |
| cytoskeleton | 1 |
| mitochondrion | 1 |
- Nucleoplasm (3)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IEA,TAS | 8302877 |
| GO:0005654 | nucleoplasm | IDA,TAS | -- |
| GO:0005737 | cytoplasm | TAS | 8302877 |
Pathways & Interactions for PAPOLA Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | mRNA Splicing - Major Pathway |
.79
|
.41
|
| 2 | RNA Polymerase II Transcription Termination | ||
| 3 | Processing of Capped Intronless Pre-mRNA | ||
| 4 | mRNA surveillance pathway | ||
| 5 | Gene Expression |
.48
|
|
Pathways by source for PAPOLA Gene
1 BioSystems pathway for PAPOLA Gene
10 Reactome pathways for PAPOLA Gene
1 KEGG pathway for PAPOLA Gene
Interacting Proteins for PAPOLA Gene
Selected Interacting proteins:
P51003-PAPOA_HUMAN
ENSP00000216277
for PAPOLA Gene via
MINT
STRING
IID
GPS-Prot Interaction Network for PAPOLA
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000398 | mRNA splicing, via spliceosome | TAS | -- |
| GO:0006369 | termination of RNA polymerase II transcription | TAS | -- |
| GO:0006378 | mRNA polyadenylation | IBA,IDA | 7590244 |
| GO:0006397 | mRNA processing | IEA | -- |
| GO:0031123 | RNA 3'-end processing | IEA | -- |
Drugs & Compounds for PAPOLA Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| pyrophosphate |
|
14000-31-8 |
|
Transcripts for PAPOLA Gene
mRNA/cDNA for PAPOLA Gene
- 10 REFSEQ mRNAs :
- 23 NCBI additional mRNA sequence :
- 26 Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000216277 4519 nts (view in UCSC)
- ENST00000392990 2588 nts (view in UCSC)
- ENST00000553357 585 nts (view in UCSC)
- ENST00000553461 892 nts (view in UCSC)
- ENST00000553689 2267 nts (view in UCSC)
CRISPR products for research
- Applied Biological Materials (abm): CRISPR Clones for PAPOLA - Starting at $85 >
- * PAPOLA CRISPR as ready-to-use vector or virus: Non-viral | Lenti- | Adeno- | AAV- | siRNA - Browse All
- * Cas9 Nucleases, Nickases, Null Mutants, and GFP tag also available.
-
OriGene CRISPR knockouts for PAPOLA
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLA
-
Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLA
miRNA products for research
Inhibitory RNAs for research
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PAPOLA
- Browse OriGene Inhibitory RNA Products For PAPOLA
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA
Clone products for research
- Applied Biological Materials (abm): Clones for PAPOLA - Starting at $45 >
- * PAPOLA as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Retro- | Protein Vector - Browse All
- * Viral Packaging Services and High Titer Production Services also available.
- Sino Biological Human cDNA Clone for PAPOLA
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLA
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | · | 1e | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | · | 4c | ^ | 5a | · | 5b | ^ | 6 | ^ | 7a | · | 7b | · | 7c | · | 7d | · | 7e | ^ | 8 | ^ | 9a | · | 9b | · | 9c | · | 9d | · | 9e | ^ | 10 | ^ | 11a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP14: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP15: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP16: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP17: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP18: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP19: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP20: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP21: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP22: |
| ExUns: | 11b | ^ | 12a | · | 12b | ^ | 13a | · | 13b | ^ | 14a | · | 14b | ^ | 15a | · | 15b | ^ | 16 | ^ | 17a | · | 17b | ^ | 18 | ^ | 19 | ^ | 20 | ^ | 21 | ^ | 22a | · | 22b | · | 22c | ^ | 23a | · | 23b | ^ | 24a | · | 24b | ^ | 25a | · | 25b | · | 25c | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP10: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP14: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP15: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP16: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP17: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP18: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP19: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP20: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP21: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP22: |
| ExUns: | 25d | · | 25e |
|---|---|---|---|
| SP1: | |||
| SP2: | |||
| SP3: | |||
| SP4: | |||
| SP5: | |||
| SP6: | |||
| SP7: | |||
| SP8: | |||
| SP9: | |||
| SP10: | |||
| SP11: | |||
| SP12: | |||
| SP13: | |||
| SP14: | |||
| SP15: | |||
| SP16: | |||
| SP17: | |||
| SP18: | |||
| SP19: | |||
| SP20: | |||
| SP21: | |||
| SP22: |
Relevant External Links for PAPOLA Gene
- GeneLoc Exon Structure for
- PAPOLA
Expression for PAPOLA Gene
This gene is overexpressed in Peripheral blood mononuclear cells (16.0), Testis (9.4), and Lymph node (8.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for PAPOLA Gene
- Elite partner
Transcriptomic regulation report from SPP (The Signaling Pathways Project) for PAPOLA
SOURCE GeneReport for Unigene cluster for PAPOLA Gene:
Hs.253726Evidence on tissue expression from TISSUES for PAPOLA Gene
- Nervous system(4.9)
- Liver(4.4)
- Spleen(2.5)
- Intestine(2.5)
- Eye(2.4)
- Kidney(2.3)
- Skin(2.3)
- Muscle(2.2)
- Blood(2.2)
- Heart(2.1)
- Lung(2)
- Stomach(2)
Primer products for research
-
OriGene qPCR primer pairs for PAPOLA
-
OriGene qPCR primer pairs and template standards for PAPOLA
Gene Expression Assays for research
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PAPOLA Gene
Orthologs for PAPOLA Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| Chimpanzee (Pan troglodytes) |
Mammalia | PAPOLA 30 31 |
|
OneToOne | |
| Dog (Canis familiaris) |
Mammalia | PAPOLA 30 31 |
|
OneToOne | |
| Oppossum (Monodelphis domestica) |
Mammalia | -- 31 |
|
ManyToMany | |
| -- 31 |
|
ManyToMany | |||
| -- 31 |
|
ManyToMany | |||
| Platypus (Ornithorhynchus anatinus) |
Mammalia | -- 31 |
|
OneToMany | |
| Cow (Bos Taurus) |
Mammalia | PAPOLA 30 31 |
|
OneToOne | |
| Mouse (Mus musculus) |
Mammalia | Papola 30 17 31 |
|
OneToOne | |
| Rat (Rattus norvegicus) |
Mammalia | Papola 30 |
|
||
| Chicken (Gallus gallus) |
Aves | PAPOLA 30 31 |
|
OneToMany | |
| Lizard (Anolis carolinensis) |
Reptilia | -- 31 |
|
OneToMany | |
| Tropical Clawed Frog (Silurana tropicalis) |
Amphibia | papola 30 |
|
||
| Str.10813 30 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | MGC68746 30 |
|
||
| Zebrafish (Danio rerio) |
Actinopterygii | papola 30 31 |
|
OneToMany | |
| Rainbow Trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.5723 30 |
|
||
| Fruit Fly (Drosophila melanogaster) |
Insecta | hrg 31 |
|
OneToMany | |
| Worm (Caenorhabditis elegans) |
Secernentea | T15H9.6 30 31 |
|
ManyToMany | |
| F43G6.5 31 |
|
ManyToMany | |||
| pap-1 31 |
|
ManyToMany | |||
| Baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | PAP1 31 |
|
OneToMany | |
| Thale Cress (Arabidopsis thaliana) |
eudicotyledons | nPAP 30 |
|
||
| Rice (Oryza sativa) |
Liliopsida | Os06g0558700 30 |
|
||
| Os.32564 30 |
|
||||
| Sea Squirt (Ciona savignyi) |
Ascidiacea | CSA.2725 31 |
|
OneToMany |
- Species where no ortholog for PAPOLA was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Eremothecium gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- Alpha proteobacteria (Wolbachia pipientis)
- Amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- Barley (Hordeum vulgare)
- Beta proteobacteria (Neisseria meningitidis)
- Bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- Common water flea (Daphnia pulex)
- Corn (Zea mays)
- E. coli (Escherichia coli)
- Filamentous fungi (Aspergillus nidulans)
- Firmicute Bacteria (Streptococcus pneumoniae)
- Fission Yeast (Schizosaccharomyces pombe)
- Green Algae (Chlamydomonas reinhardtii)
- Honey Bee (Apis mellifera)
- K. Lactis Yeast (Kluyveromyces lactis)
- Loblloly Pine (Pinus taeda)
- Malaria Parasite (Plasmodium falciparum)
- Medicago Trunc (Medicago Truncatula)
- Moss (Physcomitrella patens)
- Orangutan (Pongo pygmaeus)
- Pig (Sus scrofa)
- Rice Blast Fungus (Magnaporthe grisea)
- Schistosome Parasite (Schistosoma mansoni)
- Sea Anemone (Nematostella vectensis)
- Sea Vase (Ciona intestinalis)
- Sea Urchin (Strongylocentrotus purpuratus)
- Sorghum (Sorghum bicolor)
- Soybean (Glycine max)
- Stem Rust Fungus (Puccinia graminis)
- Sugarcane (Saccharum officinarum)
- Tomato (Lycopersicon esculentum)
- Toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- Wheat (Triticum aestivum)
Evolution for PAPOLA Gene
- ENSEMBL:
- Gene Tree for PAPOLA (if available)
- TreeFam:
- Gene Tree for PAPOLA (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for PAPOLA: view image
Paralogs for PAPOLA Gene
Variants for PAPOLA Gene
Sequence variations, with clinical significance, from ClinVar and Humsavar, with links to dbSNP for PAPOLA Gene
| SNP ID | Clinical significance and condition | Chr 14 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs148378172 | Benign: not provided | 96,531,537(+) |
T/C NM_032632.4(PAPOLA):c.558T>C (p.Asp186=) |
SYNONYMOUS_VARIANT,FIVE_PRIME_UTR | |
| rs149879119 | Benign: not provided | 96,552,590(+) |
C/T NM_032632.4(PAPOLA):c.1632C>T (p.Thr544=) |
SYNONYMOUS | |
| rs200215413 | Benign: not provided | 96,502,607(+) |
A/C NM_032632.4(PAPOLA):c.8+7A>C |
INTRON | |
| rs35861551 | Benign: not provided | 96,552,527(+) |
C/T NM_032632.4(PAPOLA):c.1569C>T (p.Leu523=) |
SYNONYMOUS | |
| rs483352759 | Conflicting Interpretations: not provided | 96,547,861(+) |
A/G NM_032632.4(PAPOLA):c.1464A>G (p.Val488=) |
SYNONYMOUS |
All consequence types are included: molecular consequences (e.g. missense, synonymous), and location-based (e.g. intron, upstream).
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv1964n100 | CNV | gain | 25217958 |
| nsv1052499 | CNV | loss | 25217958 |
| nsv977501 | CNV | duplication | 23825009 |
Residual Variation Intolerance Score:
13.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.71;
15.05% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for PAPOLA Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- PAPOLA
SNP Genotyping and Copy Number Assays for research
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PAPOLA Gene
Disorders for PAPOLA Gene
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| 46,xx sex reversal 3 |
|
|
| developmental and epileptic encephalopathy 1 |
|
|
Search PAPOLA in MalaCards
View complete list of genes associated with diseases
Additional Disease Information for PAPOLA
- Genetic Association Database
- (GAD)
- Atlas
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
- Open Targets Platform
- Open Targets Platform
No data available for UniProtKB/Swiss-Prot and Genatlas for PAPOLA Gene
Publications for PAPOLA Gene
- Multiple forms of poly(A) polymerases in human cells. (PMID: 8302877) Thuresson AC … Virtanen A (Proceedings of the National Academy of Sciences of the United States of America 1994) 2 3 4 23
- Inositol 1,4,5-triphosphate receptor-binding protein released with inositol 1,4,5-triphosphate (IRBIT) associates with components of the mRNA 3' processing machinery in a phosphorylation-dependent manner and inhibits polyadenylation. (PMID: 19224921) Kiefer H … Mikoshiba K (The Journal of biological chemistry 2009) 3 4 23
- Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase. (PMID: 14749727) Kaufmann I … Keller W (The EMBO journal 2004) 3 4 23
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4
- Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization. (PMID: 15169763) Dettwiler S … Barabino SM (The Journal of biological chemistry 2004) 3 4
ExternalLinks
Products for PAPOLA Gene
- Custom Antibody ServicesOriGene Antibodies for PAPOLA
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for PAPOLA
- Search Origene for MassSpec and Protein Over-expression Lysates for PAPOLA
- Origene Custom Protein Services for PAPOLA
- Origene shrna, sirna, and RNAi products in human, mouse, rat for PAPOLA
- Browse OriGene Inhibitory RNA Products For PAPOLA
- OriGene qPCR primer pairs for PAPOLA
- OriGene qPCR primer pairs and template standards for PAPOLA
- OriGene CRISPR knockouts for PAPOLA
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For PAPOLA
- Sino Biological Human cDNA Clone for PAPOLA
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Sino Biological Antibodies for PAPOLA
- Browse Sino Biological Assays
- Browse Antibodies
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for PAPOLA
- Novus Biologicals proteins and lysates for PAPOLA
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for PAPOLA
- Abcam proteins for PAPOLA
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for PAPOLA (AFLGC-PAPOLA)
- VectorBuilder Custom and pre-made DNA vectors for PAPOLA (ie. gene expression, shRNA knockdown, CRISPR)
- VectorBuilder Viral vectors for PAPOLA (ie. lentivirus, AAV, adenovirus)
- VectorBuilder CRISPR vectors for PAPOLA (ie. knockout, knockin, CRISPRa, CRISPRi)
- VectorBuilder Virus packaging for PAPOLA CRISPR vectors (ie. lentivirus, AAV, adenovirus)
- VectorBuilder Stable cell line generation for PAPOLA
- antibodies-online: Show 25 available PAPOLA Antibodies ranked by validation data
- Compare Top PAPOLA Antibodies
- antibodies-online: Search results for available PAPOLA related products ranked by validation data
- antibodies-online: Show 8 available PAPOLA Proteins ranked by validation data
- Compare Top PAPOLA Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for PAPOLA
- Search Santa Cruz Biotechnology (SCBT) for PAPOLA siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLA
- Custom Antibody ServicesProSci Antibodies for PAPOLA
- Search for PAPOLA Proteins at ProSci
- Horizon Cell Lines for PAPOLA
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLA
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLA
- Search GeneCopoeia for miRNA 3'UTR Target clone products for PAPOLA
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA
- Boster Bio Antibodies for PAPOLA
- Browse Boster Bio ELISA Kits
Sources for PAPOLA Gene
- (1) GeneCards
- (2) HGNC
- (3) NCBI Entrez Gene
- (4) UniProtKB/Swiss-Prot
- (5) Ensembl
- (6) OMIM® (Updated: 05-Mar-2021)
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) UniProtKB/TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) ASD
- (28) SAGE
- (29) SOURCE
- (30) HomoloGene
- (31) PanEnsembl
- (32) euGenes
- (33) SGD
- (34) FlyBase
- (35) WormBase
- (36) Pseudogene
- (37) DGV
- (38) dbSNP
- (39) GenAtlas
- (40) HGMD
- (41) GAD
- (42) BGMUT
- (43) HuGE
- (44) Atlas
- (45) GenBank
- (46) HORDE
- (47) HUGE
- (48) IMGT
- (49) Leiden
- (50) miRBase
- (51) DME
- (52) OriGene
- (53) PubMed
- (54) R&D Systems
- (55) TGDB
- (56) Tocris
- (57) Abcam
- (58) Novus Biologicals
- (59) ProSpec
- (60) Sino Biological
- (61) GenScript
- (62) Qiagen
- (63) OCA
- (64) Proteopedia
- (65) MOPED
- (66) neXtProt
- (67) Reactome
- (68) GeneGo (Thomson Reuters)
- (69) DISEASES
- (70) SIMAP
- (71) GenomeRNAi
- (72) LifeMap
- (73) miRTarBase
- (74) MalaCards
- (75) Invitrogen
- (76) BitterDB
- (77) ESI-BIO
- (78) RefSeq
- (79) BioSystems
- (80) MaxQB
- (81) IUPHAR
- (82) BioGPS
- (83) Illumina
- (84) COMPARTMENTS
- (85) HOMER
- (86) PaxDb
- (87) ApexBio
- (88) Addgene
- (89) antibodies-online
- (90) CYP
- (91) NONCODE
- (92) TreeFam
- (93) PathCards
- (94) GeneReviews
- (95) GeneTex
- (96) Taconic Biosciences
- (97) GTEx
- (98) ProteomicsDB
- (99) SCBT
- (100) DGIdb
- (101) ClinicalTrials
- (102) RVIS
- (103) SIGNOR
- (104) diseasecard
- (105) NIH Rare Diseases
- (106) Orphanet
- (107) UMLS
- (108) GTR
- (109) Disease Ontology
- (110) MedlinePlus Genetics
- (111) MeSH
- (112) MedlinePlus
- (113) CDC
- (114) NINDS
- (115) NCBI Bookshelf
- (116) ClinVar
- (117) Gene Damage Index
- (118) HPO
- (119) UDN
- (120) VISTA
- (121) FANTOM5
- (122) ENCODE
- (123) ProSci
- (124) Horizon
- (125) The Signaling Pathways Project (SPP)
- (126) IID
- (127) VectorBuilder
- (128) SNPedia
- (129) BRCA Exchange
- (130) CIViC
- (131) ProteoGenix
- (132) dbSUPER
- (133) TISSUES
- (134) Gene ORGANizer
- (135) abm
- (136) Human Protein Atlas
- (137) GWAS Catalog
- (138) Monarch Initiative
- (139) DataMed
- (140) HumanCyc
- (141) UCNEbase
- (142) EPDnew
- (143) Applied Biosystems
- (144) GlyConnect
- (145) Aminode
- (146) GeneCopoeia
- (147) GPS-Prot
- (148) RNAcentral
- (149) LncRNADisease
- (150) LOVD
- (151) miR2Disease
- (152) DiseaseEnhancer
- (153) Boster Bio
- (154) Biorbyt
- (155) Biocompare
- (156) Mastermind
- (157) CTD^2 Dashboard
- (158) CraniofacialAtlas
- (159) GeneImprint
- (160) Synthego
- (161) ENA
- (162) GtRNAdb
- (163) LncBase
- (164) LncBook
- (165) LNCipedia
- (166) Modomics
- (167) PDBe
- (168) Rfam
- (169) SILVA
- (170) snOPY
- (171) SRPDB
- (172) GENCODE
- (173) TarBase
- (174) Open Targets Platform
- (175) 5SRRNADB
- (176) snoDB
- (177) MirGeneDB