Aliases for PAPOLA Gene
Aliases for PAPOLA Gene
External Ids for PAPOLA Gene
- HGNC: 14981
- Entrez Gene: 10914
- Ensembl: ENSG00000090060
- OMIM: 605553
- UniProtKB: P51003
Previous GeneCards Identifiers for PAPOLA Gene
- GC14P094479
- GC14P090785
- GC14P094958
- GC14P096038
- GC14P096969
- GC14P077153
Summaries for PAPOLA Gene
-
The protein encoded by this gene belongs to the poly(A) polymerase family. It is required for the addition of adenosine residues for the creation of the 3'-poly(A) tail of mRNAs. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
GeneCards Summary for PAPOLA Gene
PAPOLA (Poly(A) Polymerase Alpha) is a Protein Coding gene. Among its related pathways are RNA Polymerase II Transcription Termination and mRNA surveillance pathway. Gene Ontology (GO) annotations related to this gene include RNA binding and manganese ion binding. An important paralog of this gene is PAPOLB.
UniProtKB/Swiss-Prot for PAPOLA Gene
-
Polymerase that creates the 3'-poly(A) tail of mRNA's. Also required for the endoribonucleolytic cleavage reaction at some polyadenylation sites. May acquire specificity through interaction with a cleavage and polyadenylation specificity factor (CPSF) at its C-terminus.
Additional gene information for PAPOLA Gene
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PAPOLA Gene
Genomics for PAPOLA Gene
GeneHancer (GH) Regulatory Elements for PAPOLA Gene
Promoters and enhancers for PAPOLA Gene
- Elite GeneHancer and/or Elite GeneHancer-gene association
Download GeneHancer data from 2017 publication |
Request up-to-date GeneHancer data (full dataset)
GeneHancers around PAPOLA on UCSC Golden Path with GeneCards custom track
- Top Transcription factor binding sites by QIAGEN in the PAPOLA gene promoter:
-
- AhR
- AML1a
- AP-1
- Arnt
- c-Fos
- c-Jun
- Egr-2
- FOXO4
- MRF-2
- Sox5
Genomic Locations for PAPOLA Gene
Genomic Locations for PAPOLA Gene
- chr14:96,501,433-96,567,116
- (GRCh38/hg38)
- Size:
- 65,684 bases
- Orientation:
- Plus strand
- chr14:96,967,770-97,033,448
- (GRCh37/hg19)
- Size:
- 65,679 bases
- Orientation:
- Plus strand
Genomic View for PAPOLA Gene
Genes around PAPOLA on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 14q32.2 by HGNC
- 14q32.2 by Entrez Gene
- 14q32.2 by Ensembl
PAPOLA Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for PAPOLA Gene
Proteins for PAPOLA Gene
-
Protein details for PAPOLA Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P51003-PAPOA_HUMAN
- Recommended name:
- Poly(A) polymerase alpha
- Protein Accession:
- P51003
- Q86SX4
- Q86TV0
- Q8IYF5
- Q9BVU2
Protein attributes for PAPOLA Gene
- Size:
- 745 amino acids
- Molecular mass:
- 82843 Da
- Cofactor:
- Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
- Quaternary structure:
-
- Monomer. Found in a complex with CPSF1, FIP1L1 and PAPOLA. Interacts with AHCYL1 and FIP1L1; the interaction with AHCYL1 seems to increase interaction with FIP1L1 (PubMed:19224921). Interacts with NUDT21; the interaction is diminished by acetylation. Interacts with KPNB1; the interaction promotes PAP nuclear import and is inhibited by acetylation of PAP (By similarity).
Protein Expression for PAPOLA Gene
Selected DME Specific Peptides for PAPOLA Gene
- P51003:
-
- KFFLVFS
- SLNGCRVTD
- QEEVKDLR
- QSVIENV
- FFQKYKHYIVLLASA
- SPISLAAPK
- PNFFQKY
- PFGVFEEEEELQRRIL
- NSMSVPS
- LRAIKLWA
- SESKNLP
- LPQSVIENVGGKIFTFG
- IYSNILGFLGGVSWA
- NLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
- EESPKKTKTEEDE
- WEWPNPVLLK
- ENSENLSVDLTYDIQSFTDTV
- CQLYPNA
- KAEWSKLF
- SSTDLSDI
- WAMLVAR
- EEFRTMWVIGL
- DLTYDIQSFTDTVYRQA
- LEWVGLVESKIR
Post-translational modifications for PAPOLA Gene
- Polysumoylated. Varying sumolyation depending on tissue- and cell-type. Highly sumoylated in bladder and NIH 3T3 cells. Sumoylation is required for nuclear localization and enhances PAP stability. Desumoylated by SENP1. Inhibits polymerase activity (By similarity).
- Hyperphosphorylation on multiple CDK2 consensus and non-consensus sites in the C-terminal Ser/Thr-rich region represses PAP activity in late M-phase. Phosphorylation/dephosphorylation may regulate the interaction between PAP and CPSF (By similarity).
- Acetylated in the C-terminus. Acetylation decreases interaction with NUDT21 and KPNB1, and inhibits nuclear localization through inhibiting binding to the importin alpha/beta complex (By similarity).
- Ubiquitination at isoforms=360 and isoforms=267
- Modification sites at PhosphoSitePlus
Other Protein References for PAPOLA Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Atlas Antibodies Anti-PAPOLA Antibody
-
Custom Antibody ServicesOriGene Antibodies for PAPOLA
- Novus Biologicals Antibodies for PAPOLA
-
Abcam antibodies for PAPOLA
- Invitrogen Antibodies for PAPOLA (AFLGC-PAPOLA)
-
Santa Cruz Biotechnology (SCBT) Antibodies for PAPOLA
Protein Products
- Atlas Antibodies PrEST Antigen PAPOLA
-
OriGene Purified Proteins for PAPOLA
- Search Origene for MassSpec and Protein Over-expression Lysates for PAPOLA
- Origene Custom Protein Services for PAPOLA
- antibodies-online: Search results for 8 available PAPOLA Proteins ranked by validation data
- Compare Top PAPOLA Proteins
-
Quality Products:
-
Abcam proteins for PAPOLA
Domains & Families for PAPOLA Gene
Gene Families for PAPOLA Gene
- Human Protein Atlas (HPA):
-
- Enzymes
- Plasma proteins
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for PAPOLA Gene
Suggested Antigen Peptide Sequences for PAPOLA Gene
- GenScript: Design optimal peptide antigens:
-
- Polynucleotide adenylyltransferase alpha (PAPOA_HUMAN)
Graphical View of Domain Structure for InterPro Entry
P51003- Family:
-
- Belongs to the poly(A) polymerase family.
Function for PAPOLA Gene
Molecular function for PAPOLA Gene
- UniProtKB/Swiss-Prot Function:
- Polymerase that creates the 3'-poly(A) tail of mRNA's. Also required for the endoribonucleolytic cleavage reaction at some polyadenylation sites. May acquire specificity through interaction with a cleavage and polyadenylation specificity factor (CPSF) at its C-terminus.
- UniProtKB/Swiss-Prot CatalyticActivity:
- Reaction=ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide; Xref=Rhea:RHEA:11332, Rhea:RHEA-COMP:11128, Rhea:RHEA-COMP:14647, ChEBI:CHEBI:30616, ChEBI:CHEBI:33019, ChEBI:CHEBI:83400, ChEBI:CHEBI:140626; EC=2.7.7.19;.
Enzyme Numbers (IUBMB) for PAPOLA Gene
Phenotypes From GWAS Catalog for PAPOLA Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000287 | magnesium ion binding | ISS | -- |
| GO:0003723 | RNA binding | IEA | -- |
| GO:0004652 | polynucleotide adenylyltransferase activity | TAS,IEA | -- |
| GO:0005515 | protein binding | IPI | 7590244 |
| GO:0005524 | ATP binding | IEA,ISS | -- |
Phenotypes for PAPOLA Gene
- GenomeRNAi human phenotypes for PAPOLA:
-
- Decreased viability ratio
- Increased shRNA abundance (Z-score > 2)
- Decreased shRNA abundance (Z-score < -2)
- Decreased viability in esophageal squamous lineage
- Decreased viability
- no effect
- Increased vaccinia virus (VACV) infection
- Decreased viability after Maraba virus infection
- Decreased NF-kappaB reporter expression
- Increased viability
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for PAPOLA
-
CRISPR Products
-
OriGene CRISPR knockouts for PAPOLA
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLA
- genomics-online: gRNA clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
- Applied Biological Materials (abm): CRISPR Clones for PAPOLA - Now 50% OFF >
- * PAPOLA CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * PAPOLA CRISPR applications: KO, Activation, Repression, and more - Browse All
-
Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLA
miRNA for PAPOLA Gene
- miRTarBase miRNAs that target PAPOLA
-
- hsa-mir-155-5p (MIRT005093)
- hsa-mir-130b-3p (MIRT020257)
- hsa-mir-93-5p (MIRT028127)
- hsa-mir-877-5p (MIRT037348)
- hsa-mir-320a (MIRT044470)
- hsa-let-7b-5p (MIRT052114)
- hsa-mir-1910-3p (MIRT192128)
- hsa-mir-6511a-5p (MIRT192135)
- hsa-mir-4662a-5p (MIRT441375)
- hsa-mir-153-5p (MIRT441376)
- hsa-mir-3065-5p (MIRT441377)
- hsa-mir-7-2-3p (MIRT441378)
- hsa-mir-7-1-3p (MIRT441379)
- hsa-mir-6516-5p (MIRT471617)
- hsa-mir-6807-5p (MIRT471618)
- hsa-mir-455-3p (MIRT471619)
- hsa-mir-650 (MIRT471620)
- hsa-mir-3612 (MIRT471621)
- hsa-mir-4327 (MIRT471622)
- hsa-mir-6499-3p (MIRT471623)
- hsa-mir-1827 (MIRT471624)
- hsa-mir-665 (MIRT471625)
- hsa-mir-4459 (MIRT471626)
- hsa-mir-4695-5p (MIRT471627)
- hsa-mir-8485 (MIRT609226)
- hsa-mir-6780a-5p (MIRT629186)
- hsa-mir-6779-5p (MIRT629187)
- hsa-mir-3689c (MIRT629188)
- hsa-mir-3689b-3p (MIRT629189)
- hsa-mir-3689a-3p (MIRT629190)
- hsa-mir-30b-3p (MIRT629191)
- hsa-mir-1273h-5p (MIRT629192)
- hsa-mir-7977 (MIRT629193)
- hsa-mir-6799-5p (MIRT629194)
- hsa-mir-6883-5p (MIRT629195)
- hsa-mir-6785-5p (MIRT629196)
- hsa-mir-4728-5p (MIRT629197)
- hsa-mir-149-3p (MIRT629198)
- hsa-mir-7106-5p (MIRT629199)
- hsa-mir-24-3p (MIRT629200)
- hsa-mir-4284 (MIRT629201)
- hsa-mir-2277-3p (MIRT629202)
- hsa-mir-4526 (MIRT629203)
- hsa-mir-3660 (MIRT629204)
- hsa-mir-383-3p (MIRT629205)
- hsa-mir-6871-5p (MIRT629206)
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for PAPOLA
- Browse OriGene Inhibitory RNA Products For PAPOLA
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA
- genomics-online: shRNA clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
Clone Products
-
- MG224835
- MR224835
- MR224835L1
- MR224835L1V
- MR224835L2
- MR224835L2V
- MR224835L3
- MR224835L3V
- MR224835L4
- MR224835L4V
- RC205956
- RC205956L1
- RC205956L1V
- RC205956L2
- RC205956L2V
- RC205956L3
- RC205956L3V
- RC205956L4
- RC205956L4V
- RC232377
- RC233514
- RC238557
- RC238558
- RC239460
- RC505956
- RG205956
- RG232377
- RG233514
- RR213091
- RR213091L1
- RR213091L1V
- RR213091L2
- RR213091L2V
- RR213091L3
- RR213091L3V
- RR213091L4
- RR213091L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for PAPOLA
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLA
- Applied Biological Materials (abm): Clones for PAPOLA - Now 50% OFF >
- * PAPOLA as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * PAPOLA tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
Cell Line Products
-
Horizon Cell Lines for PAPOLA
No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PAPOLA Gene
Localization for PAPOLA Gene
Subcellular locations from UniProtKB/Swiss-Prot for PAPOLA Gene
- Cytoplasm. Nucleus. Note=The 90 kDa form is nuclear while the 100 kDa and the 106 kDa forms are both nuclear and cytoplasmic.
| Compartment | Confidence |
|---|---|
| nucleus | 5 |
| cytosol | 1 |
- Nucleoplasm (4)
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005634 | nucleus | IEA,TAS | 8302877 |
| GO:0005654 | nucleoplasm | TAS,IDA | -- |
| GO:0005737 | cytoplasm | TAS,IBA | 8302877 |
Pathways & Interactions for PAPOLA Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | mRNA Splicing - Major Pathway |
.79
|
.41
|
| 2 | RNA Polymerase II Transcription Termination | ||
| 3 | Processing of Capped Intronless Pre-mRNA | ||
| 4 | mRNA surveillance pathway | ||
| 5 | Gene Expression |
.48
|
|
Pathways by source for PAPOLA Gene
1 BioSystems pathway for PAPOLA Gene
10 Reactome pathways for PAPOLA Gene
1 KEGG pathway for PAPOLA Gene
Interacting Proteins for PAPOLA Gene
Selected Interacting proteins:
P51003-PAPOA_HUMAN
ENSP00000216277
for PAPOLA Gene via
MINT
STRING
IID
GPS-Prot Interaction Network for PAPOLA
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000398 | mRNA splicing, via spliceosome | TAS | -- |
| GO:0006369 | termination of RNA polymerase II transcription | TAS | -- |
| GO:0006378 | mRNA polyadenylation | IBA,IDA | 7590244 |
| GO:0006397 | mRNA processing | IEA | -- |
| GO:0031123 | RNA 3'-end processing | IEA | -- |
Drugs & Compounds for PAPOLA Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Phosphoric acid | Approved | Pharma | 0 | |||
| 3-Sulfinoalanine | Experimental | Pharma | Target | 0 | ||
| Cordycepin Triphosphate | Experimental | Pharma | Target | 0 | ||
| Triphosphoric acid | Experimental | Pharma | Target | 0 | ||
| ATP | Investigational | Nutra | Agonist, Activator, Full agonist, Antagonist, Pore Blocker, Potentiation | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| pyrophosphate |
|
14000-31-8 |
|
Drug Products
- Atlas Antibodies PrEST Antigen PAPOLA
Transcripts for PAPOLA Gene
mRNA/cDNA for PAPOLA Gene
- (10) REFSEQ mRNAs :
- (23) Additional mRNA sequences :
- (568) Selected AceView cDNA sequences:
- (25) Ensembl transcripts including schematic representations, and UCSC links to gene/alias where relevant :
-
- ENST00000554887 547 bps (ENST00000554887.5)
- ENST00000216277 4519 bps (ENST00000216277.12)
- ENST00000553357 585 bps (ENST00000553357.5)
- ENST00000553689 2267 bps (ENST00000553689.5)
- ENST00000557320 3264 bps (ENST00000557320.5)
Unigene Clusters for PAPOLA Gene
- Poly(A) polymerase alpha:
- Representative Sequences:
CRISPR Products
-
OriGene CRISPR knockouts for PAPOLA
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLA
- genomics-online: gRNA clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
- Applied Biological Materials (abm): CRISPR Clones for PAPOLA - Now 50% OFF >
- * PAPOLA CRISPR as ready-to-use vector or virus: ORF | Lenti- | Adeno- | AAV- | Protein Vector - Browse All
- * PAPOLA CRISPR applications: KO, Activation, Repression, and more - Browse All
-
Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLA
miRNA Products
Inhibitory RNA Products
- Origene sirna, shrna, and RNAi products in human, mouse, rat for PAPOLA
- Browse OriGene Inhibitory RNA Products For PAPOLA
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA
- genomics-online: shRNA clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
Clone Products
-
- MG224835
- MR224835
- MR224835L1
- MR224835L1V
- MR224835L2
- MR224835L2V
- MR224835L3
- MR224835L3V
- MR224835L4
- MR224835L4V
- RC205956
- RC205956L1
- RC205956L1V
- RC205956L2
- RC205956L2V
- RC205956L3
- RC205956L3V
- RC205956L4
- RC205956L4V
- RC232377
- RC233514
- RC238557
- RC238558
- RC239460
- RC505956
- RG205956
- RG232377
- RG233514
- RR213091
- RR213091L1
- RR213091L1V
- RR213091L2
- RR213091L2V
- RR213091L3
- RR213091L3V
- RR213091L4
- RR213091L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for PAPOLA
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLA
- Applied Biological Materials (abm): Clones for PAPOLA - Now 50% OFF >
- * PAPOLA as ready-to-use vector or virus: ORF | Lenti- | Retro- | Adeno- | AAV- | Protein Vector - Browse All
- * PAPOLA tags and reporters available: His, HA, Myc, Flag, GFP, RFP, Luciferase - Browse All
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | · | 1e | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | · | 4c | ^ | 5a | · | 5b | ^ | 6 | ^ | 7a | · | 7b | · | 7c | · | 7d | · | 7e | ^ | 8 | ^ | 9a | · | 9b | · | 9c | · | 9d | · | 9e | ^ | 10 | ^ | 11a | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | - | - | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | - | - | - | - | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||
| SP10: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | - | - | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||
| SP14: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP15: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP16: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP17: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP18: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP19: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP20: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP21: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP22: |
| ExUns: | 11b | ^ | 12a | · | 12b | ^ | 13a | · | 13b | ^ | 14a | · | 14b | ^ | 15a | · | 15b | ^ | 16 | ^ | 17a | · | 17b | ^ | 18 | ^ | 19 | ^ | 20 | ^ | 21 | ^ | 22a | · | 22b | · | 22c | ^ | 23a | · | 23b | ^ | 24a | · | 24b | ^ | 25a | · | 25b | · | 25c | · |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP2: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP3: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP4: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP5: | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||||
| SP6: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP7: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP8: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP9: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP10: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP11: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP12: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP13: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP14: | - | - | - | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| SP15: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP16: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP17: | - | - | - | |||||||||||||||||||||||||||||||||||||||||||||||||
| SP18: | - | |||||||||||||||||||||||||||||||||||||||||||||||||||
| SP19: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP20: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP21: | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| SP22: |
| ExUns: | 25d | · | 25e |
|---|---|---|---|
| SP1: | |||
| SP2: | |||
| SP3: | |||
| SP4: | |||
| SP5: | |||
| SP6: | |||
| SP7: | |||
| SP8: | |||
| SP9: | |||
| SP10: | |||
| SP11: | |||
| SP12: | |||
| SP13: | |||
| SP14: | |||
| SP15: | |||
| SP16: | |||
| SP17: | |||
| SP18: | |||
| SP19: | |||
| SP20: | |||
| SP21: | |||
| SP22: |
Expression for PAPOLA Gene
This gene is overexpressed in Peripheral blood mononuclear cells (16.0), Testis (9.4), and Lymph node (8.3).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB and MOPED for PAPOLA Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of PAPOLA Gene:
PAPOLASOURCE GeneReport for Unigene cluster for PAPOLA Gene:
Hs.253726Evidence on tissue expression from TISSUES for PAPOLA Gene
- Nervous system(4.9)
- Liver(4.4)
- Eye(2.4)
- Intestine(2.2)
- Spleen(2.2)
- Heart(2.1)
- Lung(2)
Primer Products
-
OriGene qPCR primer pairs for PAPOLA
-
OriGene qPCR primer pairs and template standards for PAPOLA
- genomics-online: primer clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
Gene Expression Assay Products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PAPOLA Gene
Orthologs for PAPOLA Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | PAPOLA 35 34 |
|
OneToOne | |
| dog (Canis familiaris) |
Mammalia | PAPOLA 35 34 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | -- 35 |
|
OneToMany | |
| oppossum (Monodelphis domestica) |
Mammalia | -- 35 |
|
ManyToMany | |
| -- 35 |
|
ManyToMany | |||
| -- 35 |
|
ManyToMany | |||
| cow (Bos Taurus) |
Mammalia | PAPOLA 35 34 |
|
OneToOne | |
| mouse (Mus musculus) |
Mammalia | Papola 17 35 34 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Papola 34 |
|
||
| chicken (Gallus gallus) |
Aves | PAPOLA 35 34 |
|
OneToMany | |
| lizard (Anolis carolinensis) |
Reptilia | -- 35 |
|
OneToMany | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | papola 34 |
|
||
| Str.10813 34 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | MGC68746 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | papola 35 34 |
|
OneToMany | |
| rainbow trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.5723 34 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | hrg 35 |
|
OneToMany | |
| worm (Caenorhabditis elegans) |
Secernentea | T15H9.6 34 35 |
|
||
| F43G6.5 35 |
|
ManyToMany | |||
| pap-1 35 |
|
ManyToMany | |||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | PAP1 35 |
|
OneToMany | |
| thale cress (Arabidopsis thaliana) |
eudicotyledons | nPAP 34 |
|
||
| rice (Oryza sativa) |
Liliopsida | Os06g0558700 34 |
|
||
| Os.32564 34 |
|
||||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.2725 35 |
|
OneToMany |
- Species where no ortholog for PAPOLA was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Evolution for PAPOLA Gene
- ENSEMBL:
- Gene Tree for PAPOLA (if available)
- TreeFam:
- Gene Tree for PAPOLA (if available)
- Aminode:
- Evolutionary constrained regions (ECRs) for PAPOLA: view image
Paralogs for PAPOLA Gene
Variants for PAPOLA Gene
| SNP ID | Clin | Chr 14 pos | Variation | AA Info | Type |
|---|---|---|---|---|---|
| rs483352759 | conflicting-interpretations-of-pathogenicity, not provided | 96,547,861(+) | A/G | coding_sequence_variant, genic_downstream_transcript_variant, synonymous_variant | |
| rs1000018300 | -- | 96,564,154(+) | A/G | genic_downstream_transcript_variant, intron_variant | |
| rs1000023635 | -- | 96,536,365(+) | C/T | genic_downstream_transcript_variant, intron_variant | |
| rs1000051911 | -- | 96,518,288(+) | A/G | intron_variant | |
| rs1000124762 | -- | 96,556,709(+) | C/T | genic_downstream_transcript_variant, intron_variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv1964n100 | CNV | gain | 25217958 |
| nsv1052499 | CNV | loss | 25217958 |
| nsv977501 | CNV | duplication | 23825009 |
Residual Variation Intolerance Score:
13.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.71;
15.05% of all genes are more intolerant (likely to be disease-causing)
Additional Variant Information for PAPOLA Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- PAPOLA
SNP Genotyping and Copy Number Assay Products
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PAPOLA Gene
Disorders for PAPOLA Gene
Additional Disease Information for PAPOLA
- Genetic Association Database
- (GAD)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for PAPOLA Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PAPOLA Gene
Publications for PAPOLA Gene
- Multiple forms of poly(A) polymerases in human cells. (PMID: 8302877) Thuresson AC … Virtanen A (Proceedings of the National Academy of Sciences of the United States of America 1994) 2 3 4 23 58
- Inositol 1,4,5-triphosphate receptor-binding protein released with inositol 1,4,5-triphosphate (IRBIT) associates with components of the mRNA 3' processing machinery in a phosphorylation-dependent manner and inhibits polyadenylation. (PMID: 19224921) Kiefer H … Mikoshiba K (The Journal of biological chemistry 2009) 3 4 23 58
- Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase. (PMID: 14749727) Kaufmann I … Keller W (The EMBO journal 2004) 3 4 23 58
- Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization. (PMID: 15169763) Dettwiler S … Barabino SM (The Journal of biological chemistry 2004) 3 4 58
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 58
ExternalLinks
Products for PAPOLA Gene
- Custom Antibody ServicesOriGene Antibodies for PAPOLA
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for PAPOLA
- Search Origene for MassSpec and Protein Over-expression Lysates for PAPOLA
- Origene Custom Protein Services for PAPOLA
- Origene sirna, shrna, and RNAi products in human, mouse, rat for PAPOLA
- Browse OriGene Inhibitory RNA Products For PAPOLA
- OriGene qPCR primer pairs for PAPOLA
- OriGene qPCR primer pairs and template standards for PAPOLA
- OriGene CRISPR knockouts for PAPOLA
- MG224835
- MR224835
- MR224835L1
- MR224835L1V
- MR224835L2
- MR224835L2V
- MR224835L3
- MR224835L3V
- MR224835L4
- MR224835L4V
- RC205956
- RC205956L1
- RC205956L1V
- RC205956L2
- RC205956L2V
- RC205956L3
- RC205956L3V
- RC205956L4
- RC205956L4V
- RC232377
- RC233514
- RC238557
- RC238558
- RC239460
- RC505956
- RG205956
- RG232377
- RG233514
- RR213091
- RR213091L1
- RR213091L1V
- RR213091L2
- RR213091L2V
- RR213091L3
- RR213091L3V
- RR213091L4
- RR213091L4V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For PAPOLA
- Sino Biological Human cDNA Clone for PAPOLA
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse cDNA Clones
- Browse ELISA Kits
- Browse CRO Services
- High-throughput Antibody Production Service
- Protein Production Service
- Epitope Tag Antibodies & Reporter Protein Antibodies
- Lentiviral ORF Clones
- Novus Biologicals Antibodies for PAPOLA
- Novus Biologicals proteins and lysates for PAPOLA
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Browse Antibodies
- Browse Peptides and Proteins
- Browse Lysates
- Browse ELISA Kits
- Abcam antibodies for PAPOLA
- Abcam proteins for PAPOLA
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Invitrogen Antibodies for PAPOLA (AFLGC-PAPOLA)
- Cyagen custom Knockout/knockin (KOKI) mouse models for PAPOLA
- antibodies-online: Search results for 19 available PAPOLA Antibodies ranked by validation data
- Compare Top PAPOLA Antibodies
- antibodies-online: Search results for available PAPOLA related products ranked by validation data
- antibodies-online: Search results for 8 available PAPOLA Proteins ranked by validation data
- Compare Top PAPOLA Proteins
- Quality Products:
- Santa Cruz Biotechnology (SCBT) Antibodies for PAPOLA
- Search Santa Cruz Biotechnology (SCBT) for PAPOLA siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for PAPOLA
- Horizon Cell Lines for PAPOLA
- genomics-online: cdna clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
- orf clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
- genomics-online: gRNA clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
- genomics-online: primer clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
- genomics-online: shRNA clones - Search results for 115 available PAPOLA gene related products
- Overview of 115 available PAPOLA gene related products
- Browse GeneCopoeia Cell Lines
- Search GeneCopoeia for CRISPR/Cas9 clones, lentivirus and AAV products for PAPOLA
- Search GeneCopoeia for ORF cDNA, lentivirus, AAV viral particles and/or promoter clone products for PAPOLA
- Search GeneCopoeia for miRNA 3'UTR Target clone products for PAPOLA
- Search GeneCopoeia for shRNA, lentivirus and/or AAV clone products for PAPOLA
Sources for PAPOLA Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) Cell Signaling Technology
- (12) GO
- (13) TrEMBL
- (14) InterPro
- (15) ProtoNet
- (16) Blocks
- (17) MGI
- (18) IUBMB
- (19) KEGG
- (20) MINT
- (21) STRING
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) UniGene
- (28) AceView
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) HGMD
- (45) GAD
- (46) BGMUT
- (47) HuGE
- (48) Atlas
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) OCA
- (69) Proteopedia
- (70) MOPED
- (71) neXtProt
- (72) Reactome
- (73) GeneGo (Thomson Reuters)
- (74) fRNAdb
- (75) DISEASES
- (76) SIMAP
- (77) GenomeRNAi
- (78) LifeMap
- (79) miRTarBase
- (80) MalaCards
- (81) Invitrogen
- (82) BitterDB
- (83) ESI-BIO
- (84) RefSeq
- (85) BioSystems
- (86) MaxQB
- (87) IUPHAR
- (88) BioGPS
- (89) Illumina
- (90) COMPARTMENTS
- (91) HOMER
- (92) PaxDb
- (93) ApexBio
- (94) Addgene
- (95) antibodies-online
- (96) CYP
- (97) NONCODE
- (98) SwitchGear Genomics
- (99) TreeFam
- (100) PathCards
- (101) GeneReviews
- (102) GeneTex
- (103) Taconic Biosciences
- (104) GTEx
- (105) ProteomicsDB
- (106) SCBT
- (107) DGIdb
- (108) ClinicalTrials
- (109) FDA Approved Drugs
- (110) RVIS
- (111) SIGNOR
- (112) diseasecard
- (113) NIH Rare Diseases
- (114) Orphanet
- (115) UMLS
- (116) GTR
- (117) Disease Ontology
- (118) Genetics Home Reference
- (119) MeSH
- (120) MedlinePlus
- (121) CDC
- (122) NINDS
- (123) NCBI Bookshelf
- (124) ClinVar
- (125) Gene Damage Index
- (126) ViGene Biosciences
- (127) HPO
- (128) UDN
- (129) VISTA
- (130) FANTOM5
- (131) ENCODE
- (132) ProSci
- (133) Horizon
- (134) NURSA
- (135) IID
- (136) Cyagen
- (137) VectorBuilder
- (138) SNPedia
- (139) BRCA Exchange
- (140) St John's Lab
- (141) CIViC
- (142) ProteoGenix
- (143) dbSUPER
- (144) TISSUES
- (145) Gene ORGANizer
- (146) abm
- (147) CrownBio
- (148) Human Protein Atlas
- (149) GWAS Catalog
- (150) Monarch Initiative
- (151) DataMed
- (152) HumanCyc
- (153) genomics-online
- (154) UCNEbase
- (155) EPDnew
- (156) Applied Biosystems
- (157) GlyConnect
- (158) Aminode
- (159) GeneCopoeia
- (160) GPS-Prot
- (161) RNACentral
- (162) LncRNADisease
- (163) LOVD
- (164) miR2Disease
- (165) DiseaseEnhancer
- (166) Boster Bio
- (167) Biorbyt
- (168) Biocompare
- (169) Mastermind